SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022858 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022858
Domain Number 1 Region: 66-192
Classification Level Classification E-value
Superfamily Lysozyme-like 3.75e-47
Family C-type lysozyme 0.0000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022858   Gene: ENSMMUG00000017369   Transcript: ENSMMUT00000024423
Sequence length 194
Comment pep:novel chromosome:MMUL_1:9:30788164:30808180:-1 gene:ENSMMUG00000017369 transcript:ENSMMUT00000024423 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IQDAHLSCQSPTKWNSVSSADSPEKSASGAGTGNLPFQFCLQQALRMKAAGILTLIGCLV
TGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQRVLDDGSIDYGI
FQINSFTWCRHGKLQENNHCHVACSALITDDLTDAIICARKIVKETRGMNYWQGWKKHCE
GRDLSDWKKGCEVS
Download sequence
Identical sequences ENSMMUP00000036053 9544.ENSMMUP00000022858 ENSMMUP00000022858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]