SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022958 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022958
Domain Number 1 Region: 32-141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-32
Family Spermadhesin, CUB domain 0.00067
Further Details:      
 
Domain Number 2 Region: 248-381
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.65e-21
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0012
Further Details:      
 
Domain Number 3 Region: 160-242
Classification Level Classification E-value
Superfamily LCCL domain 5.1e-18
Family LCCL domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022958   Gene: ENSMMUG00000017438   Transcript: ENSMMUT00000024526
Sequence length 381
Comment pep:known chromosome:MMUL_1:2:18994171:19081406:-1 gene:ENSMMUG00000017438 transcript:ENSMMUT00000024526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLFLLLLLVLLLLLDDAGAQQGDGCGHTVLGPESGTLTSINYPQTYPNSTVCEWEIRVK
MGERVRIKFGDFDIEDSDSCHFNYLRIYNGIGVSRTEIGKYCGLGLQMNHSIESKGNEIT
LLFMSGIHVSGRGFLASYSVIDKQEQSNYLFGHCIQFWNLSSVSTPAGCLLPFAEISGTI
PHGYRDSSPLCMAGVHAGVVSNTLGGQISVVISKGIPYYESSLANNVTSVVTHVSVLSVC
FFLFFVSGCYGTLGMESGDRGSSNNSIVLEWTDHTGQENSWKPKSQAEKTWTALGFATDE
YQWLQIDLNKEKKITGIITTGSTMVTITMCLPTESCTVMMGRNGLCTESLVEQDKVFQGN
KDYHQDVRNNFLPPIIARFIR
Download sequence
Identical sequences ENSMMUP00000022958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]