SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022973 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022973
Domain Number 1 Region: 511-707
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.01e-46
Family SPRY domain 0.014
Further Details:      
 
Domain Number 2 Region: 231-292
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.98e-16
Family B-box zinc-binding domain 0.0013
Further Details:      
 
Domain Number 3 Region: 447-540
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000014
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 4 Region: 2-38,113-148
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000013
Family RING finger domain, C3HC4 0.06
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000022973
Domain Number - Region: 163-197
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00209
Family TFIIH p44 subunit cysteine-rich domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022973   Gene: ENSMMUG00000017449   Transcript: ENSMMUT00000024541
Sequence length 718
Comment pep:known_by_projection chromosome:MMUL_1:1:225741235:225796430:-1 gene:ENSMMUG00000017449 transcript:ENSMMUT00000024541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEELKCPVCGSLFREPIILPCSHNVCLPCARTIARAGGSAAGGLGGGAGGGGDHADKLS
LYSETDSGYGSYTPSLKSPNGVRVLPMVPAPPGSSAAAARGAACSSLSSSSSSITCPQCH
RSASLDHRGLRGFQRNRLLEAIVQRYQQGRGAVPGASAAAAVAICQLCDRTPPEPAATLC
EQCDVLYCAACQLKCHPSRGPFAKHRLGAPSGGSGCKSPGGAGAGATGGSTARKFPTCPE
HEMENYSMYCVSCRTPVCYLCLEEGRHAKHEVKPLGAMWKQHKAQLSQALNGVSDKAKEA
KEFLVQLKNILQQIQENGLDYEACLVAQCDALVDALTRQKAKLLTKVTKEREHKLKVVWD
QINHCTLKLRQSTGLMEYCLEVIKENDPSGFLQISDALIKRVQVSQEQWVKGALEPKVSA
EFDLTLDSEPLLQAIHQLDFIQMKCRVPPVPLLQLEKCCTRNNSVIRAWRMPPFTHSPVD
GYILELDDGAGGQFREVYVGKETLCTIDGLHFNSTYNARVKAFNSSGVGPYSKTVVLQTS
DVAWFTFDPNSGHRDIILSNDNQTATCSSYDDRVVLGTAAFSKGVHYWELHVDRYDNHPD
PAFGVARASVVKDMMLGKDDKAWAMYVDNNRSWFMHCNSHTNRTEGGVCKGATVGVLLDL
NKHTLTFFINGQQQGPTAFSHVDGVFMPALSLNRNVQVTLHTGLEVPTNLGRPKLSGN
Download sequence
Identical sequences ENSMMUP00000022973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]