SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023030 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000023030
Domain Number - Region: 161-207
Classification Level Classification E-value
Superfamily PEP carboxykinase N-terminal domain 0.0262
Family PEP carboxykinase N-terminal domain 0.0079
Further Details:      
 
Domain Number - Region: 126-149
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 0.054
Family Penicillin V acylase 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023030   Gene: ENSMMUG00000017501   Transcript: ENSMMUT00000024604
Sequence length 359
Comment pep:known_by_projection chromosome:MMUL_1:5:53640842:53666167:1 gene:ENSMMUG00000017501 transcript:ENSMMUT00000024604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTVDPEARPGLLPLLLLLLAEAGLSAASPPAAPRFNVSLDAAPELRWLPVLRHYDLDLV
RAAMAQVIGDRVPKWVHVLIGKVVLELERFLPQPFTGEIRGMCDFLNVSLADCLLVNLAY
ESSAFCTSIVAQDSRGHIYHGRNLDYPFGNVLRKLTVDVQFLKNGQIAFTGTTFIGYVGL
WTGQSPHKFTVSGDERDKGWWWENAIAALFQRHIPVSWLIRATLNESENFEAAVGKLAKT
PLIADVYYIVGGTSPQEGVVITRNRDGPADIWPLDPLNGAWFRVETNYDHWKPAPKRDDR
RTPAIKALNATGQANLSLEALFQVTCVTVENDVLTIYTTVMSAGSPDKYISRIRNPSRK
Download sequence
Identical sequences ENSMMUP00000023030 9544.ENSMMUP00000023030 ENSMMUP00000023030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]