SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023062 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023062
Domain Number 1 Region: 32-129
Classification Level Classification E-value
Superfamily SH2 domain 3.5e-23
Family SH2 domain 0.00027
Further Details:      
 
Domain Number 2 Region: 176-223
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000536
Family SOCS box-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023062   Gene: ENSMMUG00000017522   Transcript: ENSMMUT00000024640
Sequence length 225
Comment pep:known_by_projection chromosome:MMUL_1:16:73643540:73644217:-1 gene:ENSMMUG00000017522 transcript:ENSMMUT00000024640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFTLSKCPAAGMMRPLDSRLRLKTFRSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV
LKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSR
PLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
Download sequence
Identical sequences ENSMMUP00000023062 ENSMMUP00000023062 9544.ENSMMUP00000023062 NP_001181255.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]