SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023071 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023071
Domain Number 1 Region: 265-528
Classification Level Classification E-value
Superfamily p53-like transcription factors 6.63e-81
Family STAT DNA-binding domain 0.00035
Further Details:      
 
Domain Number 2 Region: 529-648
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-35
Family SH2 domain 0.00024
Further Details:      
 
Domain Number 3 Region: 1-115
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 1.29e-26
Family Transcription factor STAT-4 N-domain 0.0019
Further Details:      
 
Domain Number 4 Region: 112-273
Classification Level Classification E-value
Superfamily STAT 4.51e-26
Family STAT 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023071   Gene: ENSMMUG00000017527   Transcript: ENSMMUT00000024650
Sequence length 847
Comment pep:known chromosome:MMUL_1:11:54159742:54175574:-1 gene:ENSMMUG00000017527 transcript:ENSMMUT00000024650 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLWGLVSKMPPEKVQRLYVDFPQHLRHLLGDWLESQPWEFLVGSDAFCCNMASALLSDT
VQRLQASAGEQGEGSTILQHINTLESIYQRDPLKLVATFRQILQGEKKAVMEQFRHLPMP
FHWKQEELKFKTALRRLQHRVGEIHLLREALQKGADAGQVSLHSLIETPANGTGPSEALA
LLLQETTGELETAKALVLKRIQIWKRQQQLAGNGAPFEESLAPLQERCESLVDIYSQLQQ
EVGAAGGELEPKTRASLIGRLDEVLRTLVTSCFLVEKQPPQVLKTQTKFQAGVRFLLGLR
FLGAPAKPPLVRADMVTEKQARELSVPQGPGAGAESTGEIINNTVPLENSIPGNCCSALF
KNLLLKKIKRCERKGTESVTEEKCAVLFSASFTLGPGKLPIQLQALSLPLVVIVHGNQDN
NAKATILWDNAFSEMDRVPFVVAERVPWEKMCETLNLKFMAEVGTNRGLLPEHFLFLAQK
IFNDNSLSMEAFQHRSVSWSQFNKEILLGRGFTFWQWFDGVLDLTKRCLRSYWSDRLIIG
FISKQYVTSLLLNEPDGTFLLRFSDSEIGGITIAHVIRGQDGSPQIENIQPFSAKDLSIR
SLGDRIRDLAQLKNLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPE
LQMPTMVPSYDLGMAPDSSMSMQLGPDMVPQVYPPHSHSIPPYQGLSPEESVNVLSAFQE
PHLQMPPSLGQMSLSFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVRAF
SQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQPGISMSHMD
LRANPSW
Download sequence
Identical sequences I2CVC3
ENSMMUP00000023071 ENSMMUP00000023071 9544.ENSMMUP00000023071 NP_001252926.1.72884 XP_015007530.1.72884 XP_015007531.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]