SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023110 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023110
Domain Number 1 Region: 182-403
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 5.1e-92
Family Fibrinogen C-terminal domain-like 0.00000166
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023110   Gene: ENSMMUG00000017553   Transcript: ENSMMUT00000024691
Sequence length 404
Comment pep:known chromosome:MMUL_1:1:191861549:191875612:1 gene:ENSMMUG00000017553 transcript:ENSMMUT00000024691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKDVLSRQKREIDVLQLVVDVDGNIVNEVKLLRKESRNMNSRVTQLYMQLLHEIIRKRDN
SLELSQLENKILNVTTEMLKMATRYRELEVKYASLTDLVNNQSVMITLLEEQCLRIFSRQ
DTHVSPPLVQVVPQHIPNSHQYTPGLLGGNEIQRDPGYPRDLMPPPDLATSPTKSPFKIP
PVTFINEGPFKDCQQAKEAGHSVSGIYMIKPENSNGPMQLWCENSLDPGGWTVIQKRTDG
SVNFFRNWENYKKGFGNIDGEYWLGLENIYMLSNQDNYKLLIELEDWSDKKVYAEYSSFR
LEPESEFYRLRLGTYQGNAGDSMMWHNGKQFTTLDRDKDMYAGNCAHFHKGGWWYNACAH
SNLNGVWYRGGHYRSKHQDGIFWAEYRGGSYSLRAVQMMIKPID
Download sequence
Identical sequences 9544.ENSMMUP00000023110 ENSMMUP00000023110 ENSMMUP00000023110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]