SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023152 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023152
Domain Number 1 Region: 274-425
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.27e-48
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000000565
Further Details:      
 
Domain Number 2 Region: 428-585
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.7e-43
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000000556
Further Details:      
 
Domain Number 3 Region: 645-803
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.85e-36
Family MAM domain 0.0013
Further Details:      
 
Domain Number 4 Region: 26-141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.29e-33
Family Spermadhesin, CUB domain 0.00037
Further Details:      
 
Domain Number 5 Region: 146-263
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-32
Family Spermadhesin, CUB domain 0.00000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023152   Gene: ENSMMUG00000017588   Transcript: ENSMMUT00000024737
Sequence length 906
Comment pep:known chromosome:MMUL_1:9:33368585:33523359:-1 gene:ENSMMUG00000017588 transcript:ENSMMUT00000024737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKGLPLLCAALALALAPAGAFRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQA
PDPYQRIMINFNPHFDLEDRDCKYDYVEVFDGENENGRLWGKFCGKIAPPPVVSSGQFLF
IKFVSDYETHGAGFSIRYEIFKRGPECSQNYTTPSGVIKSPGFPEKYPNSLECTYIVFAP
KMSEIILEFESFDLEPDSNPPGGMFCRYDRLEIWDGFPDVGPHIGRYCGQKTPGRIRSSS
GILSMVFYTDSAIAKEGFSANYSVLQSSVSEDFKCMEAVGMESGEIHSDQITASSQYSTN
WSAERSRLNYPENGWTPGEDSYREWIQVDLGLLRFVTAVGTQGAISKETKKKYYVKTYKI
DISSNGEDWITIKEGNKPVLFQGNTNPTDVVVAVFPKPLITRFVRIKPATWETGISLRFE
VYGCKITDYPCSGMLGMVSGLISDSQITSSNQGDRNWMPENIRLVTSRSGWALPPAPHSY
VNEWLQIDLGEEKIVRGIIIQGGKHRENKVFMRKFKIGYSNNGSDWKMIMDDSKRKAKSF
EGNNNYDTPELRTFPALSTRFIRIYPERATHGGLGLRMELLGCEVEAPTAGPTTPNGNPV
DECDDDQANCHSGTGDDFQLTGGTTVLATEKPTVIDSTIQSEFPTYGFNCEFGWGSHKTF
CHWEHDNHVQLKWSVLTSKTGPIQDHTGDGNFIYSQADENQKGKVARLVSPVVYSQNSAH
CMTFWYHMSGSHVGTLRVKLRYQKPEEYDQLVWMAIGHQGDHWKEGRVLLHKSLKLYQVI
FEGEIGKGNLGGIAVDDISINNHISQEDCARSTPGYEGEGEGDKNISRKPGNVLKTLDPI
LITIIAMSALGVLLGAVCGVVLYCACWHNGMSERNLSALENYNFELVDGVKLKKDKLNTQ
STYSEA
Download sequence
Identical sequences A0A2K5V5E7
ENSMMUP00000023152 XP_005564995.1.63531 XP_015002219.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]