SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023170 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023170
Domain Number 1 Region: 136-315
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 3.49e-25
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0057
Further Details:      
 
Domain Number 2 Region: 86-130
Classification Level Classification E-value
Superfamily TGS-like 0.0000752
Family TGS domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023170   Gene: ENSMMUG00000017605   Transcript: ENSMMUT00000024757
Sequence length 360
Comment pep:known_by_projection chromosome:MMUL_1:3:21064749:21084534:1 gene:ENSMMUG00000017605 transcript:ENSMMUT00000024757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEALTMGVRALRLWRVASGLGISWRFIATSPASQLSPTELTEMRNDLFNKEKARQLSLTP
RTEKIEVKHVGKTDPGTVFVMNKNISTPYSCAMHLSEWYCRKSILALVDGQPWDMYKPLT
KSCEIKFLTFKDRDPGEVNKAYWRSCAMMMGCVIERAFKDEYMVNLVRAPEVPVISGAFC
YDVVLDSKLDEWMPTKENLRSFTKDAHALIYKDLPFETLEVEAKVALEIFQHNKYKIDFI
EEKASQNPERIVKLHRIGDFIDVSEGPLIPRTSICFQYEVSAVHNLQPTQPSLIRRFQGV
SLPIHLRAHFTIWDKLLERSRKMVIFLSGLHFPFSFCLFTTQSFFTTSPESYLLRGTVSE
Download sequence
Identical sequences F6WBD3 G7P1M7
ENSMMUP00000023170 ENSMMUP00000023170 9544.ENSMMUP00000023170 XP_005548955.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]