SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023282 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023282
Domain Number 1 Region: 41-78,145-187
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000143
Family Selenoprotein W-related 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023282   Gene: ENSMMUG00000017699   Transcript: ENSMMUT00000024879
Sequence length 195
Comment pep:known chromosome:MMUL_1:2:137137459:137168844:-1 gene:ENSMMUG00000017699 transcript:ENSMMUT00000024879 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLLLLLVAASAMVRSEASANLGGVPSKRLKMQYATGPLLKFQIWLECSYRRVFEEYMR
VISQRYPDIRIEGENYLPQPIYRHIASFLSVFKLVLIGLIIVGKDPFAFFGMQAPSIWQW
GQENKVYACMMVFFLSNMIENQCMSTGAFEITLNDVPVWSKLESGHLPSMQQLVQILDNE
MKLNVHMDSIPHHRS
Download sequence
Identical sequences 9544.ENSMMUP00000023282 ENSMMUP00000023282 ENSMMUP00000023282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]