SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023289 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023289
Domain Number 1 Region: 388-624
Classification Level Classification E-value
Superfamily SAICAR synthase-like 3.92e-47
Family Inositol polyphosphate kinase (IPK) 0.0000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023289   Gene: ENSMMUG00000017706   Transcript: ENSMMUT00000024886
Sequence length 626
Comment pep:known chromosome:MMUL_1:19:47082252:47104378:1 gene:ENSMMUG00000017706 transcript:ENSMMUT00000024886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRCPCRGSLSEAEAGALPVAARMGLEAPRGGRRRQPGQQRQGSSLHSEPERAGLGPAPG
TESSQTEFWTDGQTEPSAAGLGVETERPKQKTEPDRSSLRTHPERSWSELETTCPWTEAG
TDGLWTDPRRSDLQFQPEEASPWTQPGVDRPWTELETHGSQTQPERVKSWADNLWTHQNS
SNLQTHPEGACPSKEPSADGSWKELYTDGSRTQQDIEGPWTEPYTDGSQKKQDTETARKQ
PGTGGFQTQQDTDGSWTQPSTDGSQTAPGTDCLLGEPEDGPLEEPEPEELVTHLYSDLKC
SPLCPVPRLIITPETPEPEAQSVGPPSRVEGGSGGFSSASSFDESEDDVVAGGGGASDPE
DRSGSKPWKKLKTVLKYSPFVVSFRKHYPWVQLSGHAGNFQAGEDGRILKRFCQCEQRSL
EQLMKDPLRPFVPAYYGMVLQDGQTFNQMEDLLADFEGPSIMDCKMGSRWGWGSPDAGVE
GRGWAFLKRRKPVISSSPRGLRSHCLFLSEGIIQFYFQSPSRCHELWMVLNYRLCFLTCK
EGTLASACSFLNLPSLPRQVVGSSLLFVHDHTGLAKVWMIDFGKTVALPDHQTLSHRLPW
AEGNREDGYLWGLDNMICLLQGLAQS
Download sequence
Identical sequences ENSMMUP00000023289 ENSMMUP00000023289 9544.ENSMMUP00000023289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]