SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023343 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023343
Domain Number 1 Region: 280-496
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 2.75e-90
Family Fibrinogen C-terminal domain-like 0.00000285
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023343   Gene: ENSMMUG00000017745   Transcript: ENSMMUT00000024944
Sequence length 498
Comment pep:known chromosome:MMUL_1:8:109696884:109954623:-1 gene:ENSMMUG00000017745 transcript:ENSMMUT00000024944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVFLSFAFLAAILTHTGCSNQRRSPENSGRRYNRIQHGQCAYTFILPEHDGNCRESTTD
QYNTNALQRDAPHVEPDFSSQKLQHLEHVMENYTQWLQKLENYIVENMKSEMAQIQQNAV
QNHTATMLEIGTSLLSQTAEQTRKLTDVETQVLNQTSRLEIQLLENSLSTYKLEKQLLQQ
TNEILKIHEKNSLLEHKILEMEGKHKEELDTLKEEKENLQGLVTRQTYIIQELEKQLNRA
TTNNSVLQKQQLELMDTVHNLVNLCTKEGVLLKGGKREEEKPFRDCADVYQAGFNKSGIY
TIYINNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNE
FIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLIL
HGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFK
GPSYSLRSTTMMIRPLDF
Download sequence
Identical sequences A0A096N0L3 A0A2K5LRM5 A0A2K5Z4J5 G7PCH7 H9EN91
9544.ENSMMUP00000023343 ENSMMUP00000023343 ENSMMUP00000023343 NP_001253045.1.72884 XP_005563979.1.63531 XP_007999538.1.81039 XP_011849560.1.47321 XP_011849562.1.47321 XP_011912736.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]