SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023354 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023354
Domain Number 1 Region: 125-223
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.96e-27
Family Thioltransferase 0.0000136
Further Details:      
 
Domain Number 2 Region: 37-120
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000996
Family Thioltransferase 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023354   Gene: ENSMMUG00000017756   Transcript: ENSMMUT00000024957
Sequence length 225
Comment pep:novel chromosome:MMUL_1:4:3838600:3839294:1 gene:ENSMMUG00000017756 transcript:ENSMMUT00000024957 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDGAHVPELTKKVQRHACSGSFPASTDEHLKADRNLRLKKLTHAARCMLFMKGTPQDPRC
GFSEQMVEILHNSSHVFSDEEVWQGLKAYSNWPTYPQLHVSGELIIKELQTSEELDTICP
KAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNRTGVECETFDILEDKGVQ
QGLKAYSNWPAYPQLYVKGELVGRLDIVKELKENGELLPILRGEN
Download sequence
Identical sequences ENSMMUP00000023354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]