SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023374 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023374
Domain Number 1 Region: 138-380
Classification Level Classification E-value
Superfamily vWA-like 1.45e-84
Family Integrin A (or I) domain 0.000000201
Further Details:      
 
Domain Number 2 Region: 353-468
Classification Level Classification E-value
Superfamily Integrin domains 4.66e-22
Family Integrin domains 0.0011
Further Details:      
 
Domain Number 3 Region: 24-83
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000131
Family Plexin repeat 0.0015
Further Details:      
 
Domain Number 4 Region: 595-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000391
Family Integrin beta EGF-like domains 0.0037
Further Details:      
 
Domain Number 5 Region: 554-592
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000586
Family Integrin beta EGF-like domains 0.0043
Further Details:      
 
Domain Number 6 Region: 638-670
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.0000012
Family Integrin beta tail domain 0.0056
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000023374
Domain Number - Region: 520-546
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0195
Family Integrin beta EGF-like domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023374   Gene: ENSMMUG00000017767   Transcript: ENSMMUT00000024977
Sequence length 671
Comment pep:known chromosome:MMUL_1:9:33098105:33125054:-1 gene:ENSMMUG00000017767 transcript:ENSMMUT00000024977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLQLIFWIGLISSICCVFGQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPT
SARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLV
LRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDF
RIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQR
ISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQ
CHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTL
SANSSNVIQLIIDAYNSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISI
GDEVQFEISITSNKCPKKDSDSFKIRPLGFTEEVEVILQYICECECQSEGIPESPKCHEG
NGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRK
RDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCE
ASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDT
CAQECSYFNIT
Download sequence
Identical sequences ENSMMUP00000023374 9544.ENSMMUP00000023374 ENSMMUP00000023374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]