SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023410 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023410
Domain Number 1 Region: 182-208,236-473
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.7e-69
Family Nuclear receptor ligand-binding domain 0.00000000182
Further Details:      
 
Domain Number 2 Region: 129-214
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.87e-30
Family Nuclear receptor 0.00000936
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023410   Gene: ENSMMUG00000017803   Transcript: ENSMMUT00000025020
Sequence length 475
Comment pep:known chromosome:MMUL_1:14:10111700:10121903:-1 gene:ENSMMUG00000017803 transcript:ENSMMUT00000025020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APPSEGTRRGGAARPEEAAEEGPPAAPGSPRHSGPLGPHACPNALSEPQVTSTMSSQVVG
IEPLYIKAEPASPDSPKGSSETETEPPVALAPGPAPTRCLPGHKEEEDGEGAGPGEQGGG
KLVLSSLPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYSCPASNECEITKRR
RKACQACRFTKCLRVGMLKEGVRLDRVRGGRQKYKRRPEVDPLPFPGPFPAGPLAVSGGP
RKTAPVNALVSHLLVVEPEKLYAMPDPAGPDGHLPAVATLCDLFDREIVVTISWAKSIPG
FSSLSLSDQMSVLQSVWMEVLVLGVAQRSLPLQDELAFAEDLVLDEEGARAAGLGELGAA
LLQLVRRLQALRLEREEYVLLKALALANSDSVHIEDAEAVEQLREALHEALLEYEAGRAG
PGGGAERRRAGRLLLTLPLLRQTAGKVLAHFYGVKLEGKVPMHKLFLEMLEAMMD
Download sequence
Identical sequences 9544.ENSMMUP00000023410 ENSMMUP00000023410 ENSMMUP00000023410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]