SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023672 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023672
Domain Number 1 Region: 22-194
Classification Level Classification E-value
Superfamily Lysozyme-like 1.44e-20
Family G-type lysozyme 0.000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023672   Gene: ENSMMUG00000018016   Transcript: ENSMMUT00000025306
Sequence length 194
Comment pep:known_by_projection chromosome:MMUL_1:13:99192874:99206254:-1 gene:ENSMMUG00000018016 transcript:ENSMMUT00000025306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALWLLLGLLALTDLSESSNWGCYGNIQTLDTPGASCGIGRHHGLNYCGIRASERLAEI
DMPYLLKYQPTMQTIGQKYCVDPAVIAGILSRKSPGDKILVNVGDRTSMVQEPGSHAPAY
WISESQVSQMTEALTTRIKEIQRRFPTWTPDQYLRGGLCAYSGGAGYVQSSQDLSCDFCN
DVLARAKYLKRHGF
Download sequence
Identical sequences ENSMMUP00000023672 ENSMMUP00000023672 9544.ENSMMUP00000023672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]