SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023691 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023691
Domain Number 1 Region: 339-529
Classification Level Classification E-value
Superfamily CAPPD, an extracellular domain of amyloid beta A4 protein 1.07e-79
Family CAPPD, an extracellular domain of amyloid beta A4 protein 0.000000122
Further Details:      
 
Domain Number 2 Region: 12-104
Classification Level Classification E-value
Superfamily A heparin-binding domain 3.66e-41
Family A heparin-binding domain 0.00000631
Further Details:      
 
Domain Number 3 Region: 105-170
Classification Level Classification E-value
Superfamily Amyloid beta a4 protein copper binding domain (domain 2) 2.48e-28
Family Amyloid beta a4 protein copper binding domain (domain 2) 0.0000574
Further Details:      
 
Domain Number 4 Region: 270-329
Classification Level Classification E-value
Superfamily BPTI-like 1.7e-21
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023691   Gene: ENSMMUG00000018029   Transcript: ENSMMUT00000025325
Sequence length 728
Comment pep:known chromosome:MMUL_1:14:128172491:128208500:1 gene:ENSMMUG00000018029 transcript:ENSMMUT00000025325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALAANAGTGFAVAEPQIAMFCGQLNMHVNIQTGKWEPDPTGTKSCFETKEEVLQYCQEMY
PELQITNVMEANQRVTIDNWCRRDKKQCKSHTVTPFKCLVGEFVSDVLLVPEKCQFFHKE
RMEVCENHQHWHTVVKEACLTQGMTLYSYGMLLPCGVDQFHGTEYVCCPQTKIIGSVSKE
EEEEEEEEEEEEDEEEDYDIYKSEFPTEADLEDFTEAAVDEDDEDEEEGEEVVEDRDYYY
DTFKGDDYNEENPTEPNSDGPMSDKEISHDVKAVCSQEAMTGPCRAVMPRWYFDLSKGKC
VRFIYGGCGGNRNNFESEDYCMAVCKAMIPPTPLPTNDVDVYFETSADDNEHARFQKAKE
QLEIRHRNRMDRVKKEWEEAELQAKNLPKAERQTLIQHFQAMVKALEKEAASEKQQLVET
HLARVEAMLNDRRRMALENYLAALQSDPPRPHRILQALRRYVRAENKDRLHTIRHYQHVL
AVDPEKAAQMKSQVMTHLHVIEERRNQSLSLLYKVPYVAQEIQEEIDELLQEQRADVDQF
TASISETPVDVRVSSEESEEIPPFHPFHPFPALPENEDTQPELYHPMKKGSGVGEQDGGL
IGAEEKVINSKNKVDENMVIDETLDVKEMIFNAERVGGLEEERESVGPLREDFSLSSSAL
IGLLVIAVAIATVIVISLVMLRKRQYGTISHGIVEVDPMLTPEERHLNKMQNHGYENPTY
KYLEQMQI
Download sequence
Identical sequences G7ND01 G7PPP9
ENSMMUP00000023691 9544.ENSMMUP00000023691 ENSMMUP00000023692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]