SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023709 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023709
Domain Number 1 Region: 381-443
Classification Level Classification E-value
Superfamily BPTI-like 2.55e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0064
Further Details:      
 
Domain Number 2 Region: 240-303
Classification Level Classification E-value
Superfamily BPTI-like 3.97e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0043
Further Details:      
 
Domain Number 3 Region: 334-372
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000458
Family LDL receptor-like module 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000023709
Domain Number - Region: 213-242
Classification Level Classification E-value
Superfamily PKD domain 0.011
Family PKD domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023709   Gene: ENSMMUG00000018041   Transcript: ENSMMUT00000025343
Sequence length 529
Comment pep:known chromosome:MMUL_1:7:19235416:19248540:1 gene:ENSMMUG00000018041 transcript:ENSMMUT00000025343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPARTMAGTRRAPARIPAVALWLLCSLGLQGTQAGPPPAPPGLPAGADCLNLFTAGVPA
FVLDTNASVSNGATFLESPSVRRGWDCVRACCTTQNCNLALVELQPDRGEDAIAACFLIN
CLYEQNFVCKFAPREGFINYLTREVYRSYRQLQTQGFGGSGIPKTWAGIDLKVQPQEPLV
LKDVENTDWRLLRGDTDVRVERKDPNQVELWGLKEGTYLFQLTVTSSDHPEDTANVTVTV
LSTKQTEDYCLASNKVGRCRGSFPRWYYDPMEQICKSFVYGGCLGNKNNYLREEECILAC
RGVQGGPLRGSSGAQATFPQGPSMERHHPVCSGTCQPTQFRCSNGCCIDSFLECDDTPNC
PDASDEATCEKYTSGFDELQRIHFPSDKGHCVDLPDTGLCKESIPRWYYNPFSEHCARFT
YGGCYGNKNNFEEEQQCLESCGGISKKDVFGLRRENPIPNTGSVEMAVAVFLVICIVVVV
SILAYCFFKNQRKGFHRHHHHPPPTTASSTVSTTEDTEHLVYNHTTQPL
Download sequence
Identical sequences XP_014997441.1.72884 XP_014997442.1.72884 ENSMMUP00000023709 9544.ENSMMUP00000023709 ENSMMUP00000023709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]