SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023724 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023724
Domain Number 1 Region: 3811-4011
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.22e-36
Family Laminin G-like module 0.003
Further Details:      
 
Domain Number 2 Region: 3328-3439
Classification Level Classification E-value
Superfamily Cadherin-like 6.57e-32
Family Cadherin 0.00073
Further Details:      
 
Domain Number 3 Region: 3222-3327
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-30
Family Cadherin 0.0018
Further Details:      
 
Domain Number 4 Region: 1127-1256
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-30
Family Cadherin 0.0019
Further Details:      
 
Domain Number 5 Region: 2270-2386
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-29
Family Cadherin 0.00076
Further Details:      
 
Domain Number 6 Region: 3118-3221
Classification Level Classification E-value
Superfamily Cadherin-like 1.06e-28
Family Cadherin 0.00044
Further Details:      
 
Domain Number 7 Region: 2802-2910
Classification Level Classification E-value
Superfamily Cadherin-like 6.54e-28
Family Cadherin 0.0011
Further Details:      
 
Domain Number 8 Region: 1555-1657
Classification Level Classification E-value
Superfamily Cadherin-like 5.5e-27
Family Cadherin 0.0013
Further Details:      
 
Domain Number 9 Region: 921-1024
Classification Level Classification E-value
Superfamily Cadherin-like 9.71e-27
Family Cadherin 0.0012
Further Details:      
 
Domain Number 10 Region: 3016-3124
Classification Level Classification E-value
Superfamily Cadherin-like 2.49e-26
Family Cadherin 0.001
Further Details:      
 
Domain Number 11 Region: 1031-1132
Classification Level Classification E-value
Superfamily Cadherin-like 1.36e-25
Family Cadherin 0.00075
Further Details:      
 
Domain Number 12 Region: 1758-1878
Classification Level Classification E-value
Superfamily Cadherin-like 2.22e-25
Family Cadherin 0.0017
Further Details:      
 
Domain Number 13 Region: 816-919
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-25
Family Cadherin 0.00085
Further Details:      
 
Domain Number 14 Region: 137-259
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-25
Family Cadherin 0.0015
Further Details:      
 
Domain Number 15 Region: 2068-2175
Classification Level Classification E-value
Superfamily Cadherin-like 1.1e-23
Family Cadherin 0.0024
Further Details:      
 
Domain Number 16 Region: 2911-3022
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-22
Family Cadherin 0.0016
Further Details:      
 
Domain Number 17 Region: 457-557
Classification Level Classification E-value
Superfamily Cadherin-like 2e-21
Family Cadherin 0.001
Further Details:      
 
Domain Number 18 Region: 709-814
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-21
Family Cadherin 0.0014
Further Details:      
 
Domain Number 19 Region: 2175-2282
Classification Level Classification E-value
Superfamily Cadherin-like 2.62e-21
Family Cadherin 0.0015
Further Details:      
 
Domain Number 20 Region: 1449-1553
Classification Level Classification E-value
Superfamily Cadherin-like 2.62e-21
Family Cadherin 0.0016
Further Details:      
 
Domain Number 21 Region: 3432-3536
Classification Level Classification E-value
Superfamily Cadherin-like 4.14e-21
Family Cadherin 0.0012
Further Details:      
 
Domain Number 22 Region: 2382-2482
Classification Level Classification E-value
Superfamily Cadherin-like 1.06e-20
Family Cadherin 0.0031
Further Details:      
 
Domain Number 23 Region: 2583-2694
Classification Level Classification E-value
Superfamily Cadherin-like 5.14e-20
Family Cadherin 0.0011
Further Details:      
 
Domain Number 24 Region: 1661-1764
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-19
Family Cadherin 0.0022
Further Details:      
 
Domain Number 25 Region: 2485-2595
Classification Level Classification E-value
Superfamily Cadherin-like 5.42e-19
Family Cadherin 0.0018
Further Details:      
 
Domain Number 26 Region: 1357-1455
Classification Level Classification E-value
Superfamily Cadherin-like 8.64e-18
Family Cadherin 0.0075
Further Details:      
 
Domain Number 27 Region: 1233-1352
Classification Level Classification E-value
Superfamily Cadherin-like 6.28e-17
Family Cadherin 0.0038
Further Details:      
 
Domain Number 28 Region: 1871-1968
Classification Level Classification E-value
Superfamily Cadherin-like 3.27e-16
Family Cadherin 0.0045
Further Details:      
 
Domain Number 29 Region: 1977-2080
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000557
Family Cadherin 0.0017
Further Details:      
 
Domain Number 30 Region: 562-663
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000183
Family Cadherin 0.0035
Further Details:      
 
Domain Number 31 Region: 2702-2800
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000785
Family Cadherin 0.0044
Further Details:      
 
Domain Number 32 Region: 4126-4164
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000381
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 33 Region: 3541-3630
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000004
Family Cadherin 0.0087
Further Details:      
 
Domain Number 34 Region: 4091-4129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000124
Family EGF-type module 0.015
Further Details:      
 
Domain Number 35 Region: 33-147
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000171
Family Cadherin 0.0075
Further Details:      
 
Domain Number 36 Region: 367-453
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000314
Family Cadherin 0.0035
Further Details:      
 
Domain Number 37 Region: 4052-4088
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000191
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 38 Region: 4011-4055
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000373
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000023724
Domain Number - Region: 245-354
Classification Level Classification E-value
Superfamily Cadherin-like 0.0003
Family Cadherin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023724   Gene: ENSMMUG00000018051   Transcript: ENSMMUT00000025358
Sequence length 4587
Comment pep:known_by_projection chromosome:MMUL_1:5:178698598:178838809:-1 gene:ENSMMUG00000018051 transcript:ENSMMUT00000025358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRHSALLLLLLLLLQHFGDSDGSQRLEQTPLQFTHLQYNVTVHENSAAKTYVGHPVKMG
IYMTHPSWEVRYKIVSGDSENLFKAEEYVLGDFCFLRIRTKGGNTAILNREVKDHYTLIV
KAVEKNTNMEARTKVRVQVLDTNDLRPLFSPTSYSVSLPENTAIRTSIARVSATDADIGT
NGEFYYSFKDRTDMFAIHPTSGVIVLTGRLDYLETKLYEMEILAVDRGMKLYGSSGISSM
ARLTVHIEQANECAPVITAVTLSPSELDRDPTYAIVTVDDCDQGANGEIASLSIVAGDLL
QQFRTVRSFPGSKEYKVKAISGVDWDSHPFGYNLTLQAKDKGTPPQFSSVKVIHVTSPQF
KAGPVKFEKDVYRAEISEFAPPNTPVVMVKAIPGYSHLRYVFKSTPGKAKFSLNYNTGLI
SILEPVKKQQAAHFELEVTTSDRKASTKVLVKVLGANSNPPEFTQTAYKAAFDENVPIGT
TVMSLSAVDPDEGENGYVTYSITNLNHVPFVIDHFTGAVSTSENLDYELMPRVYTLRIRA
SDWGLPYRREAEVLATITLNNLNDNTPLFEKINCEGTIPRDLGMGEQITTVSAIDADELQ
LVQYQIEAGNELDLFSLNPHSGVLSLKQSLMDGLGAKVSFHSLRITATDGENFATPLYIN
ITVAASRKLVNLHCEETGVAKMLAEKLLQANKLHNQGDVEDIFFDSHSVNAHVPQFRSTL
PTGIQVKENQPVGSSVIFMNSTDLDTGFNGKLVYAISGGNEDSCFMIDMETGMLKILSPL
DRETTDKYTLNITVYDLGIPQKAAWRLLDVVVVDANDNPPEFLQESYFVEVSEDKEVHSE
IIQVEATDKDLGPNGHVTYSILTDTDKFSVDSATGVVKIMHPLDRELQHEHYLKIEARDQ
AREEPQLFSTVVLKVSLEDVNDNPPKFIPPNYRVKVREDLPEGTVIMWLEAHDPDLAQSG
QVRYSLMDHGEGNFDVDKLSGAVRIVQQLDFEKKQVYNLTVRAKDKGKPVSLSSTCYVEV
EVVDVNENLHPPVFSSFVERGVVKEDAPVGSLVMTVSAHDEDAGRDGEIRYSIRDGSGVG
VFKIGEETGIIETSDRLDRESTSHYWLTVFATDQGVVPLSSFIEIYIEVEDVNDNAPQTS
EPVYYPEILENSPKDVSVVQIEAFDPDLSSNDKLVYRITSGNPQGFFAVHPKTGLITTTS
RKLDREQQDEHILEVTVTDNGSPPKSTIARVIVKILDENDNKPQFLQKFYKIRLPEREKP
DRERNARREPLYRVIATDKDEGPNAEISYSIEEGNEHGKFFIEPKTGVVSKKFSAAGEYD
ILSIKAVDNGRPQKSSTTRLHIEWISKPKPSPEPISFEESFFTFTVMESDPVAHMIGVIS
VEPPGIPLWFDITGGNYDSHFDVDKGTGTIIVAKPLDAEQKSNYNLTVEATDGTTTILTQ
VFIKVIDTNDHRPQFSTSKYEVVIPEDTVPETEILHISAVDQDEKNRLIYTLQGSRDPLS
LKKFRLDPATGSLYTSEKLDHEAVHQHTLTVMVRDQDVPVKRNFARIVVNVSDTNDHAPW
FTASSYKGRVYESAAVGSVVLQVTALDKDKGKNAEVLYSIESGNIGNSFMIDPVLGSIKT
AKELDRSNQVEYDLIVKATDKGSPPMSEVTSVHIFVTVADNAPPKFTSKDYSVEISETVS
IGSFVGMVTAHSQSSVVYEIKDGNTGDAFDINPHSGSIITQKALDFETLPVYTLIIQGTN
MAGLSTNTTVSVQLQDENDNSPVFMQAEYTGLISESASINSVVLTDRNVPLVIRAADADK
DSNALLVYHIVEPSVHKYFAIDSSTGAIHTVLSLDYEETSTFHFTVQVHDMGTPRLFAEY
AANVTIHVIDINDCPPVFAKPLYEACLLLPTYKGVKVITVNATDADSSAFSQLIYSITEG
NIGEKFSMDYKTGALTVQNTTQLRSRYELTVRASDGRFAGLTSVKINVKESKESHLKFTQ
DVYSAVVKENSTEAKTLAVITAIGNPINEPLFYHILNPDRRFKISRTSGVLSTTGIPFDR
EQQEAFDVVVEVTEEHKPSAVAHVVVKVIVEDQNDNAPVFVNLPYYAVVKVDTEVGRVIR
HVTAVDRDSGRNGEVHYYLKEHHEYFQIGPLGEISLKKQFELDTLNKEYLVTVVAKDGGN
PAFSAEVMVPITVMNKAMPVFEKPFYSAEIAENVQVHSPVVHVQANSPEGLKVFYSITDG
DPFSQFTINFNTGVINVIAPLDFEAHPAYKLSIRATDSLTGAHAEVFVDIIVEDINDNAP
VFAQQSYAATLSEASVIGTSVVQVRATDSDSEPNRGISYQLFGNLSKSHDHFHVDSSTGL
ISLLRTLDYEQSQRHTIFVRAVDGGMPPLSSDVIVTVDVTDLNDNPPLFEQQIYEARISE
HAPHGHFVTCVKAYDADSSDIDKLQYSILSGNDHKHFIIDSATGIITLSNLRRHTLKPFY
SLNLSVSDGVFRSSTQVHVTVIGGNLHSPAFLQNEYEVELAENAPLHTLVMEVKTTDGDS
GIYGDVTYHIVNDFAKDRFYVNERGQIFTLEKLDRETPAEKVISVRLMAKDAGGKVAFCT
VNVILTDDNDNAPQFRATKYEVNIGSSAAKGTSVIKVLASDADEGSNADVTYAIEADSDS
VKENLEINKLSGVITTKESLIGLENEFFTFFVRAVDNGSPSKESVVPVYVKILPPETQLP
KFSEPFYTYTVSEDVPIGTEIDLIRAEHSGTVLYSLVKGNTPESNRDESFVIDRQSGRLK
LEKSLDHEITKWYQFSILARCTQDDREMVASVDVSIQVKDANDNSPVFESSPYEAFIVEN
LPGGSRVIQIRASDADSGTNSQVMYSLDQSQSVEVIESFAINMETGWITTLKELDHEERD
NYQIKVVASDHGEKIQLSSTAIVDVTVTDVNDSPPRFTAEIYKGTVSEDDPPGGVIAILS
TTDADSEEINRQVTYFITGGDPLGQFAVENIQNEWKVYVKKPLDREKRDNYLLTITATDG
TFSSKAIVEVKVLDANDNSPVCEKTLYSDTIPEDVLPGKLIMQISAADADIRSNAEITYT
LSGSGAEKFQLNPDTGELKTSAPLDREEQAVYHLLVRATDRGGRFCQASIVLTLEDVNDN
APEFSADPYAITVFENTEPGTLLTRVQATDADSGLNRKILYSLIDSADGQFSINELSGII
QLEKPLDRELQAVYTLSLKAVDQGLPRRLTATGTVVVSVLDINDNPPVFEYREYGATVSE
DILVGTEVLQVYAASRDIEANAEITYSIISGNEHGKFSIDSKTGAVFIIENLDYESSHEY
YLTIEATDGGTPSLSDVATVNVNVTDVNDNAPVFSQDTYTAVVSEDAVLEQSVITVLADD
ADGPSNSHIHYSIIDGNQGGPFTIDPVRGEVKVTKLLDRETISGYTLTVQASDNGSPPRV
NTTAVNIDVSDVNDNAPVFSRGNYSVIIQENKPVGFSVLRLVVTDEDSSHNGPPFVFTIV
TGNDEKAFEVNQQGVLLTASAIKRKEKDHFLLQVKVADNGKPQLSSLTYIDIRVIEESIY
PPAILPLEIFITASGEEYSGGVIGKIHATDQDVYDTLTYSLDPQMDNLFSVSSTGGKLIA
HKKLDIGQYLLNVSVTDGKFTTVADITVHIRQVTQEMLNHTIAIRFANLTPEEFVGDYWR
NFQRALRNILGVRRSDIHIVSLQPSEPHPHLDVLLFVEKSGGAQISTKQLLHKINSSVTD
IEDIIGVRILDVFQKLCAGLDCPWKFCDEKVSVDESVMSTHSTARLSFVTPRHHRAAVCL
CKEGRCPAVHHGCEDHPCPEGSECVSDPREEKHTCVCPGGRFAQCPGSSSMTLTGNSYVK
YRLTENENKLEMKLTMRLRTYSMHAVVMYARGTDYSILEIHNGRLQYKFDCGSGPGIVSV
QSIQVNDGQWHAVSLEVNGNYARLVLDQVHTASGTAPGTLKTLNLDNYVFFGGHIRQQGT
RHGRSPQVANGFRGCMDSIYLNGQELPFNSKPRSYAHMEESVGVSPGCFLTATEDCASGP
CQNGGICSPSPAGGYYCKCSALYIGTYCEISVNPCSSNPCLYGGTCVVDNGGFVCQCRGL
YTGQRCQLSPYCKDDPCKNGGTCFDSLDGAVCQCDSGFRGERCQSDIDECAGNPCRHGAL
CENTHGSYHCNCSHEYRGRHCEDAAPNQYVSTPWNIGLAEGIGIIVFIAGIFLLVVVFVL
CRKMMSRKKKHQAEPEDKHLGPTTAFLQRPYFDSKLNKNIYSDVPPQVPVRPISYTPSIP
SDSRNNLDRNSFEGSAIPEHPEFSTFNPESVHGHRKAVAVCSVAPNLPPPPPSNSPSDSD
SIQKPSWDFDYDTKVVDLDPCLSKKPLEEKPSQPYSARESLSEVQSLSSFQSESCDDNGY
HWDTSDWMPSVPLPDIQEFPNYEVIDEQTPLYSGDPNAIDTDYYPGGYDIESDFPPPPED
FPAADELPPLPPEFGDQFESIHPPRDMPAAGSLGSSSRNRQRFTLNQYLPNFYPLDMSEP
QTKGTGENSTCRESHAPYPPGYQRHLEVPTVESVPMSVYASTASCSDVSACCEVESEVMM
SDYESGDDGHFEEVAIPPLDSQQHTEV
Download sequence
Identical sequences 9544.ENSMMUP00000023724 ENSMMUP00000023724 ENSMMUP00000023724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]