SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023737 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023737
Domain Number 1 Region: 3-124
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 5.29e-40
Family Proteasome subunits 0.00000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023737   Gene: ENSMMUG00000018066   Transcript: ENSMMUT00000025373
Sequence length 124
Comment pep:known chromosome:MMUL_1:18:19119246:19137466:1 gene:ENSMMUG00000018066 transcript:ENSMMUT00000025373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGIRGTNIVVLGVEKKSVAKLQDERT
VRKICALDDHVCMAFAVLTIFIGLTADARVVINRARVECQSHKLTVEDPVTVEYITRFIA
TLKQ
Download sequence
Identical sequences ENSMMUP00000023737 ENSMMUP00000023737 9544.ENSMMUP00000023737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]