SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023782 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023782
Domain Number 1 Region: 160-240
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.53e-23
Family Translational machinery components 0.0066
Further Details:      
 
Domain Number 2 Region: 78-149
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 3.03e-18
Family Ribosomal S5 protein, N-terminal domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023782   Gene: ENSMMUG00000018097   Transcript: ENSMMUT00000025419
Sequence length 275
Comment pep:novel chromosome:MMUL_1:10:30470110:30471004:-1 gene:ENSMMUG00000018097 transcript:ENSMMUT00000025419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDDATALGGMGNRGGFRGGFGSGIRGQGHGRGLAGAEAAELAEMPVTKLGHLVKDLKIK
YLEDLFSLPINESEIIDFFLGTSLKEEVLKIMPVQKQTRAVQHTRFKAFVAIGDYNGHVG
LGVKRSKEVATAIRGAIILAKLSNVPVRRGYWGNKMGKPHTVPCKVTDRCRSVLVHLIPA
PRGTGIVWAPVPKKLLMMAGVDDCYTSARGCTATLGNFSKATFDAICKTYSSLTPDLWKE
TIFTKSPYQEFTDHLVKTHTRVSMQRTQAPAVAAT
Download sequence
Identical sequences ENSMMUP00000023782 ENSMMUP00000023782 9544.ENSMMUP00000023782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]