SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023809 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023809
Domain Number 1 Region: 438-567
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000138
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 629-671
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000958
Family EGF-type module 0.005
Further Details:      
 
Domain Number 3 Region: 782-828
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000401
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 4 Region: 663-704
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000458
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 5 Region: 746-786
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000839
Family EGF-type module 0.013
Further Details:      
 
Domain Number 6 Region: 374-416
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000109
Family EGF-type module 0.01
Further Details:      
 
Domain Number 7 Region: 338-378
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000042
Family EGF-type module 0.012
Further Details:      
 
Domain Number 8 Region: 297-341
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000858
Family EGF-type module 0.01
Further Details:      
 
Domain Number 9 Region: 707-745
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000082
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000023809
Domain Number - Region: 593-629
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00041
Family EGF-type module 0.066
Further Details:      
 
Domain Number - Region: 845-912
Classification Level Classification E-value
Superfamily FnI-like domain 0.000607
Family VWC domain 0.043
Further Details:      
 
Domain Number - Region: 414-445
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0435
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023809   Gene: ENSMMUG00000018116   Transcript: ENSMMUT00000025448
Sequence length 1219
Comment pep:known_by_projection chromosome:MMUL_1:10:43922602:43956460:-1 gene:ENSMMUG00000018116 transcript:ENSMMUT00000025448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSPRTRGRPGRPLSLLLALLCALRAKVCGASGQFELEILSMQNVNGELQNGNCCGGARN
PGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRI
VLPFSFAWPRSYTLLVEAWDSSNDTVQPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFE
YQIRVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSP
KHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGICNEPWQCLCETNWGGQLCDKDLNYC
GTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCEIAEHACLSDPCHNRGSCKETSLGFEC
ECSPGWTGPTCSTNIDDCSPNNCSHGGTCQDLVNGFKCVCPPQWTGKTCQLDANECEAKP
CVNAKSCKNLIASYYCDCLPGWMGQNCDININDCLGQCQNDASCRDLVNGYRCICPPGYA
GDHCERDIDECASNPCLNGGHCQNEINRFQCLCPTGFSGNLCQLDIDYCEPNPCQNGAQC
YNRASDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCG
PHGKCKSQSGGKFTCDCNKGFTGTYCHENINDCESNPCRNGGTCIDGVNSYKCICSDGWE
GAYCETNINDCSQNPCHNGGTCRDLVNDFYCDCKNGWKGKTCHSRDSQCDEATCNNGGTC
YDEGDAFKCMCPGGWEGTTCNIARNSSCLPNPCHNGGTCVVNGESFTCVCKEGWEGPICA
QNTNDCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRISKDWAVSSPLLAVNCTVRERN
QIKNCCLPKWFSAVRTQDVSGRPCITMGSVIPDGAKWDDDCNTCQCLNGRIACSKVWCGP
RPCLLHKGHSECPSGQSCIPILDDQCFVHPCTGVGECRSSSLQPVKTKCTSDSYYQDNCA
NITFTFNKEMMSPGLTTEHICSELRNLNILKNVSAEYSIYIACEPSPSANNEIHVAISAE
DIRDDGNPIKEITDKIIDLVSKRDGNSSLIAAVAEVRVQRRPLKNRTDFLVPLLSSVLTV
AWICCLVTAFYWCLRKRRKPGSHTHSASEDNTTNNVREQLNQIKNPIEKHGANTVPIKDY
ENKNSKMSKIRTHNSEVEEDDMDKHQQKARFAKQPAYTLVDREEKPPNGTPTKHPNWTNK
QDNRDLESAQSLNRMEYIV
Download sequence
Identical sequences 9544.ENSMMUP00000023809 ENSMMUP00000023809 ENSMMUP00000023809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]