SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023826 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023826
Domain Number 1 Region: 106-308
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.97e-52
Family Nuclear receptor ligand-binding domain 0.00000000578
Further Details:      
 
Domain Number 2 Region: 9-88
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.62e-28
Family Nuclear receptor 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023826   Gene: ENSMMUG00000018128   Transcript: ENSMMUT00000025468
Sequence length 309
Comment pep:novel chromosome:MMUL_1:1:139840137:139848175:-1 gene:ENSMMUG00000018128 transcript:ENSMMUT00000025468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASREDELRNCVVCGDQATGYHFNALTCEGCKGFFRRTVSKSIGPTCPFAGSCEVSKIQR
RHCPACRLQKCLDAGMRKDMILSAEALALRRAKQAQRRAQQTPMQLSNEQEELIQTLLGA
HTRHMGTMFEQFVQFRPPAHLFIHHQPLPTLAPVLPLVTHFADVNTFMVQQVIKFTKDLP
VFRSLPIEDQISLLKGAAVEICHIVLNTTFCLQTQNFLCGPLRYTIEDAARDRPGVTQRH
EIDQLQEEMALTLQSYIKGQQQRPRDRFLYAKLLGLLAELRSINEAYGYQIQHIQGLSAM
MPLLQEICS
Download sequence
Identical sequences XP_011768475.1.29376 XP_015310063.1.63531 ENSMMUP00000023826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]