SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023830 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023830
Domain Number 1 Region: 9-81
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.24e-27
Family Nuclear receptor 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023830   Gene: ENSMMUG00000018128   Transcript: ENSMMUT00000025472
Sequence length 147
Comment pep:novel chromosome:MMUL_1:1:139840137:139848175:-1 gene:ENSMMUG00000018128 transcript:ENSMMUT00000025472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASREDELRNCVVCGDQATGYHFNALTCEGCKGFFRRTVSKSIGPTCPFAGSCEVSKIQR
RHCPACRLQKCLDAGMRKDILCPLKTRSPFSREQLWKSVISYSIPLSVSKHKTSSAGLFA
TQLKTQPVTDLELPRDMRLISCKRRWH
Download sequence
Identical sequences A0A2K5N4M3 A0A2K5VPQ3 A0A2K5XWS1 A0A2K6BPU7 F7FBW6
ENSMMUP00000023830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]