SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023840 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023840
Domain Number 1 Region: 356-413
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.29e-26
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 468-525
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.26e-25
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 3 Region: 412-469
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.51e-22
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 4 Region: 566-618
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-21
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 88-151
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.62e-21
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 
Domain Number 6 Region: 301-357
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.14e-21
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 7 Region: 524-581
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.5e-21
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 8 Region: 245-301
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000187
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023840   Gene: ENSMMUG00000012753   Transcript: ENSMMUT00000025482
Sequence length 642
Comment pep:known_by_projection chromosome:MMUL_1:19:22736650:22752586:1 gene:ENSMMUG00000012753 transcript:ENSMMUT00000025482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTGRLPGLAGPLSLSAAGAPGFAFTALCPLFLGAESLWLRDGQVLDPYLRRQGPRKPRNG
ENAESDIPREGKGLWRDADLAALTVTFISREPLKFRDVAVEFSLEEWQCLDTIQQNLYRN
VMLENYRNLVFLDKTGIAVSKPDLITCLEQEKEPWTRKRHRMVAKPVTCSHFAQDFSPEQ
NIKDSFQKVTLRRHGKCEHENLQLRKCGKSVDECKVQKGGYNGLNQCLPATQSKLFHCDE
YMKIFHKFSNLNGHKIRHTGKKPFKCKEFGKSFCMFSNLTQRKITCTRVNFYKCEDCGKA
FNGSLIFTKHKRIHNGEKPYKCEECGKAFNLSSHITTHKIIHTGEKAYKCEECGKAFNQS
SHLTRHKIIHTGEKPYKCEECGKAFRQSSHLTTHKMIHTGEKPYKCEECGKAFNKSSHLT
RHKSIHAGEKPYQCEKCGKTSNQSSNLTEHKNIHTEEKPYKCEECGKAFKQLSNLTTHKR
IHTGEKPYKCEECGKAFNQSSILTTHKRIHTGEKSYKCEECGKAFYRSSKLTEHKKIHTR
EKRYTCEECGKAFNHSSHLTTHKVIHTGEKFYQCEECGKAFNQSSHLTRHKRIHTGEKPY
QCEKCGKAFNQSSNLTVHKKIHTDKIIHAKNRSVKNVAKLVT
Download sequence
Identical sequences ENSMMUP00000014571 ENSMMUP00000023840 9544.ENSMMUP00000023840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]