SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023878 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023878
Domain Number 1 Region: 43-417
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.83e-47
Family Integrin alpha N-terminal domain 0.013
Further Details:      
 
Domain Number 2 Region: 542-596
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000435
Family EGF-type module 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023878   Gene: ENSMMUG00000018154   Transcript: ENSMMUT00000025521
Sequence length 635
Comment pep:known_by_projection chromosome:MMUL_1:9:97475111:97607906:-1 gene:ENSMMUG00000018154 transcript:ENSMMUT00000025521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRMFLLLLWFLPITEGSQRAEPMFTAVTNSVLPPDYDSNPTQLNYGVAVTDVDHDGDFE
IVVAGYNGPNLVLKYDRAQKRLVNIAVDERSSPYYALRDRQGNAIGVTACDIDGDGREEI
YFLNTNNAFSGVATYTDKLFKFRNNRWEDILSDEVNVARGVASLFAGRSVACVDRKGSGR
YSIYIANYAYGNVGPDALIEMDPEASDLSQGILALRDVAAEAGVSKYTGGRGVSVGPILS
SSASDIFCDNENGPNFLFHNRGDGTFVDAAASAGVDDPHQHGRGVALADFNRDGKVDIVY
GNWNGPHRLYLQMSAHGKAHFRDIASPKFSMPSPVRTVITADFDNDQELEIFFNNIAYRS
SSANRLFRVIRREHGDPLIEELNPGDALEPEGRGTGGVVTDFDGDGMLDLILSHGESMAQ
PLSVFRGNQGFNNNWLRVVPRTRFGAFARGAKVVLYTKKSGAHLRIIDGGSGYLCEMEPV
AHFGLGKDEASSVEVTWPDGKMVSRNVASGEMNSVLEIPYPRDEDTLQNPAPLECGQGFS
QQENGHCMDTNECIQFPFVCPRDKPVCVNTYGSYRCRTNKRCSRGYEPNEDGTACVAQVA
FLGGYSSATFRISEPLSRASYLSLGLGLCLQLYAL
Download sequence
Identical sequences A0A1D5R323
ENSMMUP00000023878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]