SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023997 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023997
Domain Number 1 Region: 273-444
Classification Level Classification E-value
Superfamily p53-like transcription factors 7.15e-59
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000207
Further Details:      
 
Domain Number 2 Region: 443-552
Classification Level Classification E-value
Superfamily E set domains 1.51e-30
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023997   Gene: ENSMMUG00000018255   Transcript: ENSMMUT00000025652
Sequence length 1530
Comment pep:known chromosome:MMUL_1:20:67948336:68081233:1 gene:ENSMMUG00000018255 transcript:ENSMMUT00000025652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSDFISLLSADLDLESPKSLYSRESVYDLLPKELQLPPSRETSVASMSQTSGGEAGSPP
PAVVAADASSAPSSSSMGGACSSFTTSSSPTIYSTSVTDSKAMQVESCSSAVGVSNRGVS
EKQLTSNTVQQHPSTPKRHTVLYISPPPEDLLDNSRMSCQDEGCGLESEQSCSMWMEDSP
SNFSNMSTSSYNDNTEVPRKSRKRNPKQRPGVKRRDCEESNMDIFDADSAKAPHYVLSQL
TTDNKGNSKAGNGTLENQKGTGVKKSPMLCGQYPVKSEGKELKIVVQPETQHRARYLTEG
SRGSVKDRTQQGFPTVKLEGHNEPVVLQVFVGNDSGRVKPHGFYQACRVTGRNTTPCKEV
DIEGTTVIEVGLDPSNNMTLAVDCVGILKLRNADVEARIGIAGSKKKSTRARLVFRVNIT
RKDGSTLTLQTPSSPILCTQPAGVPEILKKSLHSCSVKGEEEVFLIGKNFLKGTKVIFQE
NVSDENSWKSEAEIDMELFHQNHLIVKVPPYHDQHITLPVSVGIYVVTNAGRSHDVQPFT
YTPDPAAAGALNVNVKKEISSPARPCSFEEAMKAMKTTGCNLDKVNIIPNALITPLIPSS
MIKSEDVTPMEVTAEKRSSTIFKTTKTVGSTQQALENISNIAGNGSFSSPSSSHLPSENE
KQQQIQPKAYNPETLTTIQTQDISQPGTFPAVSASSQLPNSDALLQQATQFQTRETQSRE
VLQSDGTVVNLSQLTEASQQQQQSPLQEQAQTLQQQISSNIFPSPNSVSQLQNTIQQLQA
GSFTGSTASGSSGSVDLVQQVLEAQQQLSSVLFSAPDGNENVQEQLSADIFQQVSQIQSG
VSPGMFSSTEPTVHTRPDNLLPGRAESVHPQSENTLSNQQQQQQQQQVMESSAAMVMEMQ
QSICQAAAQIQSELFPSTASANGNLQQSPVYQQTSHMMSALSTNEDMQMQCELFSSPPAV
SGNETSTTTTQQVATPGTTMFQTSSSGDGEETGTQAKQIQNSVFQTMVQMQHSGDNQPQV
NLFSSTKSMMSVQNSGTQQQGNGLFQQGNEMMSLQSGNFLQQSSHSQAQLFHPQNPIADA
QNLSQETQGSLFHSPNPIVHSQTSTTSSEQMQPPMFHSQSTIAVLQGSSVPQDQQSTNIF
LSQSPMNNLQTNTVAQEAFFAAPNSISPLQSTSNTEQQAAFQQQAPISHIQTPMLSQEQA
QPPQQGLFQPQVSLGSLPPNPMPQSQQGTMFQSQHSIVAMQSNSPSQEQQQQQQQQQQQQ
QQQQQGILFSNQNTMATMASPKQPPPNMIFNPNQNPMANQEQQNQSIFHQQSNMAPMNQE
QQPMQFQSQSTVSSLQNPGPTQSESSQTPLFHSSPQIQLVQGSPSSQEQQVTLFLSPASM
SALQTSINQQDMQQSPLYSPQNNMPGIQGASSSPQPQATLFHNTAGGTMNQLQNSPGSSQ
QTSGMFLFGIQNNCSQLLTSGPATLPDQLMAISQPGQPQNEGQPPVTTLLSQQMPENSPL
ASSINTNQNIEKIDLLVSLQNQGNNLTGSF
Download sequence
Identical sequences A0A2K6DIS9 H9FNY1
XP_011755989.1.29376 XP_014981988.1.72884 ENSMMUP00000023995 9544.ENSMMUP00000023997 ENSMMUP00000023997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]