SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024020 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024020
Domain Number 1 Region: 137-337
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.73e-48
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.035
Further Details:      
 
Domain Number 2 Region: 22-111
Classification Level Classification E-value
Superfamily WWE domain 2.75e-17
Family WWE domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024020   Gene: ENSMMUG00000018273   Transcript: ENSMMUT00000025675
Sequence length 338
Comment pep:known chromosome:MMUL_1:11:3929060:3981026:-1 gene:ENSMMUG00000018273 transcript:ENSMMUT00000025675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWEANPEMFHKAEEFFSKTTNNEVDDMDTSDTQWGWFYLAECGKWHMFQPDTNSQCSVSS
EDIEKSFKTNPCGSISFTTSKFSYKIDFAEMKQMNLTTGKQRLIKRAPFSISAFSYICEN
EAIPMPPHWENVNTQVPYQLIPLHNQTHEYNEVANLFGKTMDRNRIKRIQRIQNLDLWEF
FCRKKAQLKKKRGVPQINEQMLFHGTSSEFVEAICIHNFDWRINGIHGAVFGKGTYFARD
AAYSSRFCKDDIKHGNTFQIHGVSLQQRHLFRTYKSMFLARVLIGDYINGDSKYMRPPSK
DGSYVNLYDSCVDDTWNPKIFVVFDANQIYPEYLIDFH
Download sequence
Identical sequences A0A096NEC0 A0A2K5U114 A0A2K6AB45 A0A2K6E6U9 A0A2K6KDH4 A0A2K6PY86 F7HM89
9544.ENSMMUP00000024020 ENSPANP00000011237 NP_001252770.1.72884 XP_005569905.1.63531 XP_010357442.1.97406 XP_011743780.1.29376 XP_011822567.1.47321 XP_017720685.1.44346 ENSMMUP00000024020 ENSMMUP00000024020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]