SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024133 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024133
Domain Number 1 Region: 1-210
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 6.11e-58
Family Proteasome subunits 0.00000000485
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024133   Gene: ENSMMUG00000018354   Transcript: ENSMMUT00000025794
Sequence length 215
Comment pep:known chromosome:MMUL_1:10:2404586:2408944:1 gene:ENSMMUG00000018354 transcript:ENSMMUT00000025794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGVRGRDIVVLGVEKKSVAKLQDERTVRKICALDDNVCMAFAGLTADARIVINRARVECQ
SHRLTVEDPVTVEYITRYIASLKQRYTQSNGRPFGISALIVGFDFDGTPRLYQTDPSGTY
HAWKANAIGRGAKSVREFLEKNYTDEAIETDDLTIKLVIKALLEVVQSGGKNIELAVMRR
DQPLKILNPEEIEKYVAEIEKEKEENEKKKQKKAS
Download sequence
Identical sequences 9544.ENSMMUP00000024133 ENSMMUP00000024133 ENSMMUP00000024133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]