SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024195 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024195
Domain Number 1 Region: 96-365
Classification Level Classification E-value
Superfamily EndoU-like 1.03e-94
Family Eukaryotic EndoU ribonuclease 0.00000701
Further Details:      
 
Domain Number 2 Region: 47-87
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000000301
Family Somatomedin B domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024195   Gene: ENSMMUG00000018399   Transcript: ENSMMUT00000025858
Sequence length 370
Comment pep:known chromosome:MMUL_1:11:44778329:44793125:-1 gene:ENSMMUG00000018399 transcript:ENSMMUT00000025858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRACIPLVLAVLCSLAWAEDHKESEPLPQPEEETEEALASNLYSAPTSCQGRCYEAFDKH
HQCHCNARCQEFGNCCKDFESLCSDHEGFSHSSDAITKEEIQSISEKIYRADTNKAQKED
IILNSQNCISLSETRDQRDRCPKPLFTYVNEKLFSKPTYAAFINLLNNYQRATGHGEHFS
AQELAEQDAFLREIMKTAVMKELYSFLHHQNRYGSEQEFINDLKNMWFGLYSRGNEEGDS
SGFEHVFSGEVKKGKVTGFHNWIRFYLEEKEGLVDYYSHIYDGPWDSYPDVLAMQFNWDG
YYKEVGSAFIGSSPEFEFALYSLCFIARPGKVCQLSLGGYPLAVRTYTWDKSTYGNGKKH
IATAYIVSSA
Download sequence
Identical sequences F7GZB4
ENSMMUP00000024195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]