SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024287 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024287
Domain Number 1 Region: 1575-1817
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.09e-53
Family Ankyrin repeat 0.000000992
Further Details:      
 
Domain Number 2 Region: 510-551
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000005
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 3 Region: 548-589
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000586
Family EGF-type module 0.0039
Further Details:      
 
Domain Number 4 Region: 472-514
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000839
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 5 Region: 965-1006
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000882
Family EGF-type module 0.015
Further Details:      
 
Domain Number 6 Region: 586-623
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000125
Family EGF-type module 0.013
Further Details:      
 
Domain Number 7 Region: 765-803
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000152
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 8 Region: 274-316
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000214
Family EGF-type module 0.018
Further Details:      
 
Domain Number 9 Region: 356-477
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000345
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 10 Region: 928-966
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000411
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 11 Region: 191-230
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000447
Family EGF-type module 0.01
Further Details:      
 
Domain Number 12 Region: 155-198
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000176
Family EGF-type module 0.013
Further Details:      
 
Domain Number 13 Region: 807-931
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000926
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 14 Region: 675-800
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000127
Family Growth factor receptor domain 0.0046
Further Details:      
 
Domain Number 15 Region: 1003-1048
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000232
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 16 Region: 233-277
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000008
Family EGF-type module 0.026
Further Details:      
 
Domain Number 17 Region: 311-357
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000858
Family EGF-type module 0.01
Further Details:      
 
Domain Number 18 Region: 28-61
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000578
Family EGF-type module 0.026
Further Details:      
 
Domain Number 19 Region: 63-114
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000755
Family EGF-type module 0.02
Further Details:      
 
Domain Number 20 Region: 1215-1245
Classification Level Classification E-value
Superfamily Notch domain 0.0000112
Family Notch domain 0.0065
Further Details:      
 
Domain Number 21 Region: 1044-1090
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000161
Family EGF-type module 0.01
Further Details:      
 
Domain Number 22 Region: 117-153
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000234
Family EGF-type module 0.02
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000024287
Domain Number - Region: 1174-1203
Classification Level Classification E-value
Superfamily Notch domain 0.00314
Family Notch domain 0.0034
Further Details:      
 
Domain Number - Region: 1088-1125
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00409
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 1133-1171
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00767
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 623-654
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0166
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024287   Gene: ENSMMUG00000018461   Transcript: ENSMMUT00000025955
Sequence length 1999
Comment pep:known chromosome:MMUL_1:4:31817256:31846463:-1 gene:ENSMMUG00000018461 transcript:ENSMMUT00000025955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPPSLLLLLLLLCVSVVITRGLLCGTFPEPCANGGTCLTLSLGQGTCQCAPGFLGETCQ
FPDPCQNAQLCQNGGSCQALLPAPLGPPSSPSPLAPSFSCTCLPGFTGERCQAQLEDPCP
PSFCSKRGHCHIQASGRPQCSCMPGWTGEQCQLRDFCSANPCVNGGVCLATYPQIQCRCP
PGFEGHACERDVNECFQDPGPCPKGTSCHNTLGSFQCLCPVGREGPRCELRAGPCPPRGC
SNGGTCQLMPGKDSTFHLCLCPSGFIGPDCEVNPDNCVNHQCQNGGTCRDGLDTYTCLCP
ETWTGWDCSEDVDECEAQGPPHCRNGGTCQNSAGSFHCVCVSGWGGTSCEENLDDCIAAT
CAPGSTCIDRVGSFSCLCPPGRTGLLCHLEDMCLSQPCHGDAQCSTNPLTGSTLCLCQPG
YSGPTCHQDLDECLMAQQGPSPCEHGGSCLNTPGSFNCLCPPGYTGSRCEADHNECLSQP
CHPGSTCLDLLATFHCLCPPGLEGQLCEVETNECASDPCLNHADCHDLLNGFQCICLPGF
AGTRCEEDIDECSSSPCANGGQCQDQPGAFHCKCLPGFEGPRCQTEVDECLSDPCPVGAS
CLDLPGAFFCLCPSGFTGQLCEVPLCAPNLCQPKQICKDQKDKANCLCPDGSPGCAPPED
NCTCHHGHCQRSSCVCDVGWTGPECEAELGGCVSAPCAHGGTCYPQPSGYNCTCPIGYTG
PTCSEEMTACHSGPCLNGGSCNPSPGGYYCTCPPSHTGPQCQTITDYCVSAPCFNGGTCV
NRPSTFSCLCAMGFQGRRCEGKIRPSCADSPCRNRATCQDSPQGPRCLCPTGYTGGSCQT
LMDLCAQKPCPRNSHCLQTGPSFHCLCLQGWTGPLCNLPLSSCQKAALNQGIDVSSLCQN
GGLCVDSGPSYFCHCPPGFQGSLCQDHVNPCESRPCQHGATCMAQPSGYLCQCAPGYNGQ
NCSKELDACQSQPCHNHGTCTPKPGGFHCACPPGFVGLRCEGDVDECLDQPCHPTGTAAC
HSLANAFYCQCLPGHTGQWCEVEIDPCHSQPCFHGGTCEATAGSPLGFICHCPKAKGFEG
PTCSHRAPSCGLHHCHHGGLCLPSPKPGFPPRCACLNGYGGPDCLTPPAPKGCGPPSPCL
YNGSCSETTGLGGPGFRCSCPHSSPGPRCQKPGAKGCEGRSGDGACDAGCSGPGGNWDGG
DCSLGVPDPWKGCPSHSRCWLLFRDGQCHPQCDSEECLFDGYDCETPPACTVMGWHQYLI
QHLTEGKGPWTLLQKQRTAWEGTERGHKHWGDLTKLIVPQLPSLSNQSPGGHKIWGILSR
VKRRVRFREVLNRVSPCHPGWCAVARSQLTASSTSQVHTILLPQPPKREPLHLAANFCIF
SREGILPCWPGWHEPLCPTSTYIIIPISQIKKPRQRQAIKLVQSGLFVTLSLPPAPPANQ
LPWPVLCSPVAGVILLALGALLVLQLIRRRRREHGALWLPPGFTRRPRTQSAPHRRRPPL
GEDSIGLKALKPEAEVDEDGVVMCSGPEEGEEVGQAEETGPPSKCQFWSLSGGCGELPQA
AMLTPPQESEMEAPDLDTRGPDGVTPLMSAVCCGEAESRTFQGAWLGCPGPWEPLLDGGA
CPQAHTVGTGETPLHLAARFSRPTAARRLLEAGANPNQPDRAGRTPLHAAVAADAREVCQ
LLLRSRQTAVDARTEDGTTPLMLAARLAAEDLVEELIAAQADVGARDKWGKTALHWAAAV
NNARAARSLLQAGADKDAQDSREQTPLFLAAREGAVEVAQLLLGLGAARELRDQAGLAPA
DVARQRNHWDLLTLLEGAGPLEARHKATPGRESGPFPRARTTSVSVPPHGGGALPRCRTL
SAGAGPRGGGACRQARTWSVDLAVRGGRAYSHCRSFSGGGAGGGPPPRGRRFSAGMRGPR
PNPAIMRGSYGVAAGRGGRGPTDDWPCDWVALGACGPASNIPNPPSCLTPSPERGSPQLD
WGPPAHQEMPINQGGEGKK
Download sequence
Identical sequences ENSMMUP00000024287 ENSMMUP00000024287 9544.ENSMMUP00000024287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]