SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Macaca mulatta 76_1 > ENSMMUP00000024343

Domain assignment for ENSMMUP00000024343 from Macaca mulatta 76_1

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSMMUP00000024343
Domain Number 1	Region: 276-333
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	1.13e-23
Family	Classic zinc finger, C2H2	0.0038
Further Details:

Domain Number 2	Region: 179-239
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	2.06e-21
Family	Classic zinc finger, C2H2	0.0024
Further Details:

Domain Number 3	Region: 318-370
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	1.18e-17
Family	Classic zinc finger, C2H2	0.0071
Further Details:

Domain Number 4	Region: 233-286
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	2.21e-17
Family	Classic zinc finger, C2H2	0.0059
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSMMUP00000024343 Gene: ENSMMUG00000018500 Transcript: ENSMMUT00000026014
Sequence length	377
Comment	pep:known chromosome:MMUL_1:8:145882037:145908966:1 gene:ENSMMUG00000018500 transcript:ENSMMUT00000026014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MAALGDVQKSPSVPSPVSLSSPGTPGAQHHEPQLHLHGHQHGSPSSSPEMLSRPSELDLQ DIEEVEIGRNTFWPDSEPEPEQAPRSPGSPAPDEGAGGALRSLLRSLPRRARCGAGFGPE SSAERPAGQPPGAVPCAQPRGAWRVTLVPQAAAGPEGAPERAAELGVNFGRSRQGSARGA KPHRCESCGKSFKYNSLLLKHQRIHTGEKPYACSQCGKAFIWSSVLIEHQRIHTGEKPYE CADCGKAFRGRSHFFRHLRTHTGEKPFACCRECGQAFSQSSNLLQHQRVHTGERPFACQD CGRAFSRSSFLREHRRIHTGEKPHECGHCGRAFRALSGFFRHQRLHTGEKPFRCTECGRA FRLSFHLIQHQRVHGAE
Download sequence
Identical sequences	ENSMMUP00000024343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]