SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024343 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024343
Domain Number 1 Region: 276-333
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-23
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 2 Region: 179-239
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.06e-21
Family Classic zinc finger, C2H2 0.0024
Further Details:      
 
Domain Number 3 Region: 318-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-17
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 4 Region: 233-286
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.21e-17
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024343   Gene: ENSMMUG00000018500   Transcript: ENSMMUT00000026014
Sequence length 377
Comment pep:known chromosome:MMUL_1:8:145882037:145908966:1 gene:ENSMMUG00000018500 transcript:ENSMMUT00000026014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALGDVQKSPSVPSPVSLSSPGTPGAQHHEPQLHLHGHQHGSPSSSPEMLSRPSELDLQ
DIEEVEIGRNTFWPDSEPEPEQAPRSPGSPAPDEGAGGALRSLLRSLPRRARCGAGFGPE
SSAERPAGQPPGAVPCAQPRGAWRVTLVPQAAAGPEGAPERAAELGVNFGRSRQGSARGA
KPHRCESCGKSFKYNSLLLKHQRIHTGEKPYACSQCGKAFIWSSVLIEHQRIHTGEKPYE
CADCGKAFRGRSHFFRHLRTHTGEKPFACCRECGQAFSQSSNLLQHQRVHTGERPFACQD
CGRAFSRSSFLREHRRIHTGEKPHECGHCGRAFRALSGFFRHQRLHTGEKPFRCTECGRA
FRLSFHLIQHQRVHGAE
Download sequence
Identical sequences ENSMMUP00000024343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]