SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024353 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024353
Domain Number 1 Region: 160-268
Classification Level Classification E-value
Superfamily Cadherin-like 8.9e-26
Family Cadherin 0.00029
Further Details:      
 
Domain Number 2 Region: 269-384
Classification Level Classification E-value
Superfamily Cadherin-like 5.28e-24
Family Cadherin 0.00081
Further Details:      
 
Domain Number 3 Region: 381-497
Classification Level Classification E-value
Superfamily Cadherin-like 4.06e-21
Family Cadherin 0.017
Further Details:      
 
Domain Number 4 Region: 489-597
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-20
Family Cadherin 0.0012
Further Details:      
 
Domain Number 5 Region: 78-167
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000003
Family Cadherin 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024353   Gene: ENSMMUG00000018511   Transcript: ENSMMUT00000026026
Sequence length 799
Comment pep:known chromosome:MMUL_1:20:59946371:60332563:-1 gene:ENSMMUG00000018511 transcript:ENSMMUT00000026026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPERLAEMLLDLWTPLIILWITLPPCIYMAPMNQSQVLMSGSPLEINSLGEEQRILNRSK
RGWVWNQMFVLEEFSGPEPILVGRLHTDLDPGSKKIKYILSGDGAGTIFQINDVTGDIHA
IKRLDREEKAEYTLTAQAVDWETSKPLEPPSEFIIKVQDINDNAPEFLNGPYHATVPEMS
ILGTSVTNVTATDADDPVYGNSAKLVYSILEGQPYFSIEPETAIIKTALPNMDREAKEEY
LVVIQAKDMGGHSGGLSGTTTLTVTLTDVNDNPPKFAQSLYHFSVPEDVVLGTAIGRVKA
NDQDIGENAQSSYDIIDGDGTALFEITSDAQAQDGIIRLRKPLDFETKKSYTLKVEAANV
HIDPRFSGRGPFKDTATVKIVVEDADEPPVFSSPTYLLEVHENAALNSVIGQVTARDPDI
TSSPIRFSIDRHTDLERQFNINADDGKITLATPLDRELSVWHNITIIATEIRNHSQISRV
PVAIKVLDVNDNAPEFASEYEAFLCENGKPGQVIQTVSAMDKDDPKNGHYFLYSLLPEMV
NNPNFTIKKNEDNSLSILAKHNGFNRQKQEVYLLPIIISDSGNPPLSSTSTLTIRVCGCS
NDGVVQSCNVEAYVLPIGLSMGALIAILACIILLLVIVVLFVTLRRHKNEPLIIKDDEDV
RENIIRYDDEGGGEEDTEAFDIATLQNPDGINGFLPRKDIKPDLQFMPRQGLAPVPNGVD
VDEFINVRLHEADNDPTAPPYDSIQIYGYEGRGSVAGSLSSLESTTSDSDQNFDYLSDWG
PRFKRLGELYSVGESDKET
Download sequence
Identical sequences G7Q1A7 H9FND6
ENSMMUP00000024353 ENSMMUP00000024353 NP_001244834.1.72884 XP_005592182.1.63531 XP_007991738.1.81039 XP_007991739.1.81039 XP_011756274.1.29376 XP_011756275.1.29376 XP_011756276.1.29376 XP_011919446.1.92194 XP_014981796.1.72884 9544.ENSMMUP00000024353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]