SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024379 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024379
Domain Number 1 Region: 65-252
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.61e-72
Family T-box 0.000000599
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024379   Gene: ENSMMUG00000018529   Transcript: ENSMMUT00000026052
Sequence length 385
Comment pep:known_by_projection chromosome:MMUL_1:14:6817674:6826760:1 gene:ENSMMUG00000018529 transcript:ENSMMUT00000026052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAFLSAGFGILAPSETYPLPTTSSGWEPQLGSPFPSGPCTSSTGAQAVAESNGQGPKNP
RVSSVTVQLEMKPLWEEFNQLGTEMIVTKAGRRMFPPFQVKILGMDSLADYALLMDFIPL
DDKRYRYAFHSSAWLVAGKADPATPGRVHFHPDSPAKGAQWMRQIVSFDKLKLTNNLLDD
NGHIILNSMHRYQPRFHVVFVDPRKDSERYAQENFKSFIFTETQFTAVTAYQNHRITQLK
IASNPFAKGFRESDPDSWPVAPQPLLSVPARSHSSLSPCLLKGATERKKDPNKASASTSR
TPARLHHQLLPPSEALLAPATYRPVTYQSLYSGASNHLGIPRTRPAPYPLPNIRADSDQG
GLPLPAGLGLLSPTVVCLGPGQDSQ
Download sequence
Identical sequences A0A2K5UDB5
ENSMMUP00000024379 ENSMMUP00000024379 XP_005577096.1.63531 XP_014969038.1.72884 9544.ENSMMUP00000024379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]