SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024438 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024438
Domain Number 1 Region: 961-1064
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000126
Family Calponin-homology domain, CH-domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024438   Gene: ENSMMUG00000018579   Transcript: ENSMMUT00000026115
Sequence length 1066
Comment pep:known_by_projection chromosome:MMUL_1:16:19647834:19876072:1 gene:ENSMMUG00000018579 transcript:ENSMMUT00000026115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSAAKPWSPAIRAGGHGPDRARPLPAAPSGMKSSKSSTSLAFESRLSRLKRASSEDTLN
KPGSTTASGVARLKKTATAGAISELAESRLRSGTGAFTTTKRTGIPAPREFSVTVSRERS
VPRGPSNPRKSVSSPTSSNTPTPTKHLRTPSTKPKQENEGGEKAALESQVRELLAEAKAK
DSEINRLRSELKKCKEKRTLSAEGPDALGPNVDGTSVSPGDTEPVIRALEEKNKNFQKEL
SNLEEENRALKEKLIYLEHSPNSEGAASHTGDSSCPTSITQESSFGSPAGNQLSSDIDEY
KKNIHGNALRTSGSSSSDVTKASLSPDASDFEHITAETPSRPLSSTSNPFKSSKCSPTGS
SPNNVSELSLASLTEKIQKMEENHHSTAEELQATLQELSDQQQMVQELTAENEKLVDEKT
ILETSFHQHRERAEQLSQENEKLMNLLQERVKNEEPTTQEGKILELEQKCTGILEQGRFE
REKLLNIQQQLTCSLRKVEEENQGALEMIKRLKEENEKLNEFLELERHNNNMMAKTLEEC
RVTLEGLKTENGSLKSHLQGEKQKAIEASAMEQTAESCEVQEMLKVARAEKDLLELSCNE
LRQELLKANGEIKHVSSLLAKVEKDYSYLKEICDHQAEQLSRTSLKLQEKASESDAEIKD
MKETIFELEDQVEQHRAVKLHNNQLISELESNVIKLEEQKSDLERQLKTLTKQMKEDTEE
WRRFQADLQTAVVVANDIKCEAQQELRTVKRKLLEEEEKNARLQKELGDVQGHGRVVTSR
ATPPPVDEEPESPEVDAAGRWPGVCVSRTSPTPPESATTVKSLIKSFDLGRPGGAGQNIS
VHKTPRSPLSGIPVRTAPAAAVSPMQRHSTYSSVRPASRGVTQRLDLPDLPLSDILKGRT
ETLKPDPHLRKSPSLESLSRPPSLGFGDTRLLSASTRAWKPQSKLSVERKDPLAALAREY
GGSKRNALLKWCQKKTQGYADHASPRVYSSAPHAWMALEMFVWTLLPALRAEQLVSRKRN
LLLAFEAAESVGIKPSLELSEMLYTDRPDWQSVMQYVAQIYKYFET
Download sequence
Identical sequences 9544.ENSMMUP00000035107 ENSMMUP00000024438 ENSMMUP00000035107 ENSMMUP00000024438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]