SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024518 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024518
Domain Number 1 Region: 160-228
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.11e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Domain Number 2 Region: 71-138
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000131
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 
Domain Number 3 Region: 516-565
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000123
Family RING finger domain, C3HC4 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024518   Gene: ENSMMUG00000018639   Transcript: ENSMMUT00000026196
Sequence length 570
Comment pep:known chromosome:MMUL_1:7:61183706:61188035:-1 gene:ENSMMUG00000018639 transcript:ENSMMUT00000026196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSSLFADLERNGSGGGGGGGGGSGGGETLDDQRALQLALDQLSLLGLDSDEGASLYDSE
PRKKSVNMTECVPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKE
DVAMARREIISAAEHFSMIRASRNKNTALNGAVPGPPNLPGQTTIQVRVPYRVVGLVVGP
KGATIKRIQQQTHTYIVTPSRDKEPVFEVTGMPENVDRAREEIEAHIALRTGGIIELTDE
NDFHANGTDVGFDLHHGSGGSGPGSLWSKPTPSITPTPGRKPFSSYRNDSSSSLGSASTD
SYFGGGTSSSAAATPRLADYSPPSPALNFAHNGNNNNNGNGYTYTAGEASVPSPDGCPEL
QPTFDPAPAPPPGAPLLWAQFERSPGGGPAAPVSSSCSSSASSSASSSSVVFPGGGASAP
SNANLGLLVHRRLHPGTSCPRLSPPLHMAPGAGEHHLARRVRSDPGGGGLAYAAYANGLG
AQLPGLQPSDTSGSSSSSSSSSSSSSSSSGLRRKGSRDCSVCFESEVIAALVPCGHNLFC
MECANRICEKSEPECPVCHTAVTQAIRIFS
Download sequence
Identical sequences ENSMMUP00000024518 XP_001110186.1.72884 ENSMMUP00000024518 9544.ENSMMUP00000024518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]