SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024521 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024521
Domain Number 1 Region: 196-386
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.25e-48
Family Reprolysin-like 0.00015
Further Details:      
 
Domain Number 2 Region: 406-481
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 1.01e-21
Family Blood coagulation inhibitor (disintegrin) 0.00032
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000024521
Domain Number - Region: 667-704
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.0196
Family AN1-like Zinc finger 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024521   Gene: ENSMMUG00000013355   Transcript: ENSMMUT00000026199
Sequence length 820
Comment pep:known_by_projection chromosome:MMUL_1:5:166969725:167034558:1 gene:ENSMMUG00000013355 transcript:ENSMMUT00000026199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVLLLLHWLGVFLSCSGHIQVEHPQYHSPPDVVIPVRVTGTARGMKPPGWLSYILPFGG
QKHIIHMKVKKFLFSKHLPVFTYTDQGAILEDQPFVQNNCYYHGYVEGDPESLVSLSTCF
GGFQGILQINDIAYEIKPLAFSTTFEHLVYKMDSKEKQFSTMRSGFMQNEITCRMEFEEI
DNSTLKQSSYVGWWIHFRIIEMVVVIDNYLYIRYKRNDSQLLEDLYVIFNIVDSIFDVIG
VKVLLFGLEIWTNKNFIVIDDVRKSLHLYCKWKLDNMTPRLRHDTSHIFTSRGLRGLSGI
GAVSGMCTLDRSCAIVTFMNKTLGTFSIAVAHHLGHNLGMNHDYGTCRCSQYLCIMHEIN
PPITKFSNCSYGDFWAHTVERTKCLLENLYTKDIFNRKRCGNGIVEEGEECDCGPLKHCA
KDPCCLSNCTLTDGSTCAFGLCCKDCKFLPSGEVCRKEANECDLPEWCNGTSHKCPDDVY
VEDGIPCKERSYCYEKSCHDRNEQCRRIFGAGANTASQTCYKQLNTLGERVGHCGIKNAS
YIKCNISDVQCGRIQCENVTEIPSLSDHTTVHWARFNDIMCWSTDYHLGMKGPDIGEVKD
GTECGIDHICIHRHCVHITILNSNCSPAFCNKRGICNNKHHCHCNYLWDPPNCLIQGYGG
SIDSGPPPKRKKKKKFCYLCLLLLIVLFILLYCLYRLCKKHKPIKKQQDVQTRSAKEEEK
ILHPSHELPSHSQPRVTPSQSQPPVTPSQSQPRVMPSQSQPPVTPSQSQPRVMPSQSQPP
VMPSQRQPQLTPSQSQRPVTPSQSQPWVTPSQSQPHVTLS
Download sequence
Identical sequences 9544.ENSMMUP00000017555 ENSMMUP00000017555 ENSMMUP00000024521 ENSMMUP00000017555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]