SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024622 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024622
Domain Number 1 Region: 139-198
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.03e-20
Family KRAB domain (Kruppel-associated box) 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000024622
Domain Number - Region: 49-120
Classification Level Classification E-value
Superfamily Tropomyosin 0.00432
Family Tropomyosin 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024622   Gene: ENSMMUG00000018710   Transcript: ENSMMUT00000026303
Sequence length 282
Comment pep:known_by_projection chromosome:MMUL_1:3:186578826:186609767:1 gene:ENSMMUG00000018710 transcript:ENSMMUT00000026303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAAPARAPKTDKHTEDQSPSTPLPQPAAEKNSYLYSTEITLWTVVAAIQALEKKVDSC
LARLLTLEGRTGTAEKKLADCEKTAVEFGNQLEGKWAVLGTLLQEYGLLQRRLENVENLL
RNRNFWILRLPPGSKGESPKVPVTFDDVAVYFSELEWGKLEDWQKELYKHVMRGNYETLV
SLDYAISKPDILTRIERGEEPCLDGWGQEKQNEVEVGHPRMLGTGLPPYPEHLTSPLSPA
QEELKEGQAPKQQQDSEVRVAPVGPGAGGVCLGTDLQGEAQI
Download sequence
Identical sequences ENSMMUP00000024622 9544.ENSMMUP00000024622 ENSMMUP00000024622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]