SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024865 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024865
Domain Number 1 Region: 112-193
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.01e-29
Family Nuclear receptor 0.0000919
Further Details:      
 
Domain Number 2 Region: 180-194,283-323,378-452
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.75e-17
Family Nuclear receptor ligand-binding domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024865   Gene: ENSMMUG00000018898   Transcript: ENSMMUT00000026568
Sequence length 468
Comment pep:known chromosome:MMUL_1:11:96268142:96310680:-1 gene:ENSMMUG00000018898 transcript:ENSMMUT00000026568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATIEEIAHQIIEQQMGEIVTEQQTGQKIQIVTALDHNTQGKQFILTNHDGSTPSKVILA
RQDSTPGKVFLTTPDAAGVNQLFFTTPDLSAQHLQLLTDNSSPDQGPNKVFDLCVVCGDK
ASGRHYGAVTCEGCKGFFKRSIRKNLVYSCRGSKDCIINKHHRNRCQYCRLQRCIAFGMK
QDSVQCERKPIEVSREKSSNCAASTEKIYIRKDLRSPLTATPTFVTDSETTRSTGLLDSG
MFVNIHPSGVKTESTVLMTSDKAESCQGDLSTLASVVTSLANLGKTKDLSQNSNEMSMIE
SLSNDDTSLCEFQEMQTNGDVSRAFDTLAKALNPGESTACQSSVAGMEGSVHLITGDSSI
NYTEKEGPLLSDSHVAFRLTMPSPMPEYLNVHYIGESASRLLFLSMHWALSIPSFQALGQ
ENSISLVKAYWNELFTLGLAQCWQVMNVATILATFVNCLHNSLQQAEG
Download sequence
Identical sequences A0A2I3NEU2 A0A2K5LI44 F7A0M4
ENSMMUP00000024865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]