SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024931 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024931
Domain Number 1 Region: 20-185
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.74e-44
Family Thioltransferase 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024931   Gene: ENSMMUG00000018947   Transcript: ENSMMUT00000026639
Sequence length 226
Comment pep:known chromosome:MMUL_1:13:99264034:99279547:-1 gene:ENSMMUG00000018947 transcript:ENSMMUT00000026639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEADASVDMFSKVLENQLLQTTKLVEEHLDSEIQKLDQMDEDELERLKEKRLEALRKAQQ
QKQEWLSKGHGEYREIPSERDFFQEVKESKKVVCHFYRDSAFRCKILDRHLAILSKKHLE
TKFLKLNVEKAPFLCERLRIKVIPTLALVKDGKTQDYVVGFTDLGNTDDFTTESLEWRLG
CSDILNYSGNLMEPPFQNQKKFGTNFTKLEKKTIRGKKYDSDSDDD
Download sequence
Identical sequences A0A096N1D8 A0A2K5KE34 A0A2K5KXT2 A0A2K5ZPX3 A0A2K6DWW3 A0A2K6R8U9 F6YEB0 G7PMT3
NP_001181196.1.72884 XP_001104266.1.72884 XP_005575130.1.63531 XP_005575131.1.63531 XP_008006350.1.81039 XP_010385072.1.97406 XP_011753692.1.29376 XP_011753693.1.29376 XP_011811957.1.43180 XP_011811958.1.43180 XP_011824998.1.47321 XP_011911020.1.92194 XP_014968394.1.72884 ENSPANP00000006106 ENSMMUP00000024931 ENSMMUP00000024931 9544.ENSMMUP00000024931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]