SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024998 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024998
Domain Number 1 Region: 94-226
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.08e-16
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 2 Region: 53-101
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000167
Family EGF-type module 0.014
Further Details:      
 
Domain Number 3 Region: 210-257
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000039
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024998   Gene: ENSMMUG00000019012   Transcript: ENSMMUT00000026716
Sequence length 368
Comment pep:known chromosome:MMUL_1:14:8582258:8588118:1 gene:ENSMMUG00000019012 transcript:ENSMMUT00000026716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCINHYGGYLCLPRSAAVINDLHGEGPPPPVPPAQHPNPCPPGYEPDDQESCVDVDECA
QALHDCRPSQDCHNLPGSYQCTCPDGYRKIGPECVDIDECRYRYCQHRCVNLPGSFRCQC
EPGFQLGPNNRSCVDVNECDMGAPCEQRCFNSYGTFLCRCHQGYELHRDGFSCSDIDECS
YSSYLCQYRCINEPGRFSCHCPQGYQLLATRLCQDIDECESGAHQCSEAQTCVNFHGGYR
CVDTNRCVEPYVQVSDNRCLCPASNPLCREQPSSIVHRYMTITSERSVPADVFQIQATSV
YPGAYNAFQIRAGNSQGDFYIRAQGAPLTGAGSSVPRASATPRGEEVTRRADSRPWPRDV
DLAGLQGS
Download sequence
Identical sequences ENSMMUP00000024998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]