SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025018 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025018
Domain Number 1 Region: 143-251
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-25
Family Cadherin 0.00024
Further Details:      
 
Domain Number 2 Region: 252-367
Classification Level Classification E-value
Superfamily Cadherin-like 3e-23
Family Cadherin 0.0012
Further Details:      
 
Domain Number 3 Region: 363-486
Classification Level Classification E-value
Superfamily Cadherin-like 4.57e-23
Family Cadherin 0.00092
Further Details:      
 
Domain Number 4 Region: 64-150
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000136
Family Cadherin 0.0016
Further Details:      
 
Domain Number 5 Region: 473-577
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000257
Family Cadherin 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025018   Gene: ENSMMUG00000006009   Transcript: ENSMMUT00000026739
Sequence length 781
Comment pep:known chromosome:MMUL_1:7:85876687:85885624:-1 gene:ENSMMUG00000006009 transcript:ENSMMUT00000026739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWGLVRLLLAWLGGWGCMGRLAAPARAWAGSRGHPGPALLRTRRSWVWNQFFVIEEYAGP
EPVLIGKLHSDVDRGEGRTKYLLTGEGAGTVFVIDEATGNIHVTKSLDREEKAQYVLLAQ
AVDRASNRPLEPPSEFIIKVQDINDNPPIFPLGPYHATVPEMSNVGTSVIQVTAHDADDP
SYGNSAKLVYTVLDGLPFFSVDPQTGVVRTAIPNMDRETQEEFLVVIQAKDMGGHMGGLS
GSTTVTVTLSDVNDNPPKFPQSLYQFSVVETAGPGTLVGRLRAQDPDLGDNALMAYSILD
GEGSEAFSISTDSQGRDGLLTVRKPLDFESRRSYAFRVEATNTLIDPAYLRRGPFKDVAS
VRVVVQDAPEPPAFTQAAYHLTVPENKAPGTLVGQISAADLDSPASPIRYSILPHSDPER
CFSIQPEEGTIHTAAPLDREARVWHNLTVLATELDSSAQASRVQVTIQTLDENDNAPQLA
EPYDTFVCDSAAPGQLIQVIQALDRDEVGNSSHVSFQGPLGPDANFTVRDNRDGSASLLL
PSRPAPPRQAPYLVPIELWDWGQPALSSTATVTVSVCRCQPDGSVASCWPEAHLSAAGLS
TGALLAIITCVGALLALVVLFVALRRQKQEALMVLEEEDVRENIITYDDEGGGEEDTEAF
DITALQNPDGAAPQAPGPPARRDVLPRARVSRQPRPPGPADVAQLLVLRLREADEDPSVP
PYDSVQVYGYEGRGSSCGSLSSLGSGSEAGGVPGPAEPLDDWGPLFRTLAELYGAKEPPA
P
Download sequence
Identical sequences A0A2K5TYS2 F6RAF1
XP_014998873.1.72884 XP_015309059.1.63531 XP_015309060.1.63531 ENSMMUP00000025018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]