SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025038 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025038
Domain Number 1 Region: 510-660
Classification Level Classification E-value
Superfamily EF-hand 6.84e-51
Family Osteonectin 0.00000186
Further Details:      
 
Domain Number 2 Region: 455-507
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000388
Family Ovomucoid domain III-like 0.00053
Further Details:      
 
Domain Number 3 Region: 428-452
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000157
Family Follistatin (FS) module N-terminal domain, FS-N 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025038   Gene: ENSMMUG00000019047   Transcript: ENSMMUT00000026760
Sequence length 661
Comment pep:known_by_projection chromosome:MMUL_1:5:80435732:80502020:-1 gene:ENSMMUG00000019047 transcript:ENSMMUT00000026760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTGLFFLCILGTAAAIPTNARLLSDHAKPTAEMVAPDNTAIPNLRAEDAENEKETAVSP
EDHSHRKAEKSSVLKSKEESHEQSAEQGKSSSQELGLKDQEDRDGDFSVNLEYAPTEGIL
DIKEDMSEPQEKKPSENTDFLAPGVSSFIDSNQQESITKREENQEQPRNYSHHQLNKSSK
HSQDLRDQGNQEQDPNISNGEEEEEKEPGEVGTHNDNQEGKTELPREDANSKREEDNTQS
DDILEESDQPTQVSKMQEDEFEQDNQEQEDDNSNAETEEENASNINKHISETEWPSQEGK
TGLEAISNHKEIDEKTVSEALLMEPTDDGTTMPRNHGADDDGGDDGDDGPRHSAGDDYFI
PSQAFLEAERAQSIAYHLKIEEQREKAHENENIDTSEPGEHQEAKKAENSSNDEETSSEG
NMRVHGVDSCMSFQCKRGHICKVDQQGKPHCVCQDPVTCPPTKLLDQVCGTDNQTYASSC
HLFATKCRLEGTKKGHQLQLDYFGACKSIPTCTDFEVTQFPLRMRDWLKNILMQLYEANS
EHAGYLNEKQRNKVKKIYLDEKRLLAGDHPIDLLLRDFKKNYHMYVYPVHWQFSELDQHP
MDRVLTHSELAPLRASLVPMEHCITRFFEECDPNKDKHITLKEWGHCFGIKEEDIDENLL
F
Download sequence
Identical sequences 9544.ENSMMUP00000025038 ENSMMUP00000025038 ENSMMUP00000025038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]