SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025067 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025067
Domain Number 1 Region: 12-149,180-199
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.67e-42
Family Calponin-homology domain, CH-domain 0.0000337
Further Details:      
 
Domain Number 2 Region: 7977-8132
Classification Level Classification E-value
Superfamily Spectrin repeat 3.12e-21
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 3 Region: 8379-8493
Classification Level Classification E-value
Superfamily Spectrin repeat 3.01e-19
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 4 Region: 7757-7881
Classification Level Classification E-value
Superfamily Spectrin repeat 1.17e-18
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 5 Region: 3336-3458
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-17
Family Spectrin repeat 0.0073
Further Details:      
 
Domain Number 6 Region: 6896-7038
Classification Level Classification E-value
Superfamily Spectrin repeat 7.13e-17
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 7 Region: 3741-3888
Classification Level Classification E-value
Superfamily Spectrin repeat 8.28e-17
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 8 Region: 7349-7480
Classification Level Classification E-value
Superfamily Spectrin repeat 1.92e-16
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 9 Region: 4431-4588
Classification Level Classification E-value
Superfamily Spectrin repeat 3.34e-16
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 10 Region: 7007-7152
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000419
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 11 Region: 6685-6825
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000537
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 12 Region: 2462-2592
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000555
Family Spectrin repeat 0.0081
Further Details:      
 
Domain Number 13 Region: 4213-4369
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000792
Family Spectrin repeat 0.0097
Further Details:      
 
Domain Number 14 Region: 3120-3244
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000035
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 15 Region: 7886-7995
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000806
Family Spectrin repeat 0.0099
Further Details:      
 
Domain Number 16 Region: 1409-1543
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000932
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 17 Region: 2680-2813
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000137
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 18 Region: 561-703
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000398
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 19 Region: 1632-1762
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000419
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 20 Region: 7276-7383
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000111
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 21 Region: 7547-7697
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000158
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number 22 Region: 2834-2951
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000237
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 23 Region: 8456-8602
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000486
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 24 Region: 5661-5732,5843-5889
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000549
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 25 Region: 4882-5002
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000116
Family Spectrin repeat 0.0094
Further Details:      
 
Domain Number 26 Region: 1091-1229
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000648
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 27 Region: 1927-2078
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000912
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 28 Region: 1715-1868
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000192
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 29 Region: 2054-2193
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000204
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 30 Region: 2251-2379
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000028
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 31 Region: 1519-1625
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000389
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 32 Region: 5396-5515
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000417
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 33 Region: 5103-5202
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000496
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 34 Region: 3463-3568
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000157
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 35 Region: 3899-4057
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000171
Family Spectrin repeat 0.009
Further Details:      
 
Domain Number 36 Region: 5520-5611
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000308
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 37 Region: 3037-3132
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000131
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 38 Region: 6480-6563
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000134
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 39 Region: 4130-4258
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000222
Family Spectrin repeat 0.008
Further Details:      
 
Domain Number 40 Region: 3570-3679
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000456
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 41 Region: 4800-4912
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000903
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 42 Region: 6303-6408
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000126
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 43 Region: 6002-6116
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000288
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number 44 Region: 4986-5068
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000544
Family Spectrin repeat 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000025067
Domain Number - Region: 3247-3328
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00036
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number - Region: 2407-2475
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00037
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 6612-6722
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000518
Family Spectrin repeat 0.0039
Further Details:      
 
Domain Number - Region: 4584-4698
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000667
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number - Region: 891-1010
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00182
Family Spectrin repeat 0.0092
Further Details:      
 
Domain Number - Region: 4044-4146
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00432
Family Spectrin repeat 0.0086
Further Details:      
 
Domain Number - Region: 5209-5300
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0112
Family Spectrin repeat 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025067   Gene: ENSMMUG00000019048   Transcript: ENSMMUT00000026792
Sequence length 8742
Comment pep:known chromosome:MMUL_1:4:110426748:110960088:1 gene:ENSMMUG00000019048 transcript:ENSMMUT00000026792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSRGASRCPRDIANVMQRLQDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDG
VKLLALLEVLSGQKLPCEQGRRMKRIHAVANIGTALKFLEGRKSMHRGSPIKLVNINSTD
IADGRPSIVLGLMWTIILYFQIEELTSNLPQLQSLSSSASSVDSIVSSETPSPPSKRKVT
TKIQGNAKKALLKWVQYTAGNPSHLCKRTLLGRWGRASHGTKLLVRSSLRRERSDGSVEK
EDSKDSELGVEAEGTDRRERRKIWDDKRMPGHQAPQTICPFFDKNHPGLNQSGINQQLNK
CTDTNKIIMSPCFQREDRLILKEMKVWIEQFERDLTRAQMVESNLQDKYQSFKHFRVQYE
MKRKQIEHLVQPLHRDGKLSLDQALVKQSWDRVTSRLFDWHIQLDKSLPAPLGTIGAWLY
RAEVALREEITIQQVHEETANTIQRKLEQHKDLLQNTDAHKRAFHEIYRTRSVNGIPVPP
DQLEDMAERFHFVSSTSELHLMKMEFLELKYRLLSLLVLAESKLKSWIIKYGRRESVEQL
LQNYVSFIENSKFFEQYEVTYQILKQTAEMYVKADGSVEEAENVMKFMNETTAQWRNLSV
EVRSVRSMLEEVISNWDRYGNTVASLQAWLEDAEKMLNQSEIAKKDFFRNLPHWIQQHTA
MNDAGNFLIETCDEMVSRDLKQQLLLLNGRWRELFMEVKQYAQADEMDRMKKEYTDCVVN
LSAFATEAHKKLCEPLEVSFMNVKLLIQDLEDIEQRVPVMDAQYKIITKTAHLITKESPQ
EEGKEMFATMSKLKEQLTKVKECYSPLLYESQQLLIPLEELEKQMTSFYDSLGKINEIIT
VLEREAQSSALFKQKHQELLACQENCKKTLTLIEKGSQSVQKFVTLSNVLKHFDQTRLQR
QIADVHVAFQSMVKKTGDWKKHVETNSRLMKKFEESRAELEKVLRIAQEGLEEKGDPEEL
LRRHTEFFSQLDQRVLNAFLKACDELTDILPEQEQQGLQEAVRKLHKQWKVSQDRTETPL
SVLRSKCKRNLEIPGKTQDAEVAVSQDLTTVLQPGSEKIIKEHVFFSDKGPHHLCEKRLQ
LIEELCVKLPVRDPVRDTPGTCHATLKELRAAIDSTYRKLMEDPDKWKDYTNRFSEFSSW
ISTNETQLKGIKGEAIDTANHREVKRAVEEIRNGVTKRGETLSWLKSRLKVLTEVSSENQ
AQKQGDELAKLSSSFKALVTLLSEVEKMVSNFGDCVQYKEIVKNSLEELISGSKEVQEQA
EKILDTENLFEAQQLLLHHQQKTKRISAKKRDVQQQIAQAQQEEGGLPDRGREELRKLES
TLDGLERSRERQERRIQVTLRKWERFETNKETVVRYLFQTGSSHERFLSFSSLESLSSEL
EQTKEFSKRTENIAVQAENLVKEASEIPLGPQNKQLLQQQAQSIKEQVKKLEDTLEEDIK
TMEMVKTKWDHFGSNFETLSVWITEKEKELNALETSSSAMDMQISQIKVTIQEIESKLSS
IVGLEEEAQSFAQFVTTGESARIKAKLTQIRRYWEELREHAQCLEGTILGHLSQQQKFEE
NLRKIQQSVSEFEDKLAVPIKICSSATETYKVLQEHMDLCQALESLSSLITTFSASARKV
VNRDSCVQEAVALQHQYEDTLRRAKETQTALENLLAHWQRLEKELSSFLTWLERGEAIAS
SPEMDISADRVKVEGELQLIQASSRKFVSQASFYSKLLQLKESLFSIASKDDVKMVKLHL
EQLDERWRDLPQIIDKRINFLQSVVAEHQQFDELLLSFSVWIKLFLSELQTTSEISIMDH
QVALTRHKDHAAEVESKKVELQSLQGHLAKLGSLGRAEDLHLLQGKAEDCFQLFEEASQV
VERRQLALSHLAEFLQSHASLSGILHQLRQTVEATNSMNKNESDLIEKDLNDALQDAKAL
ESAAVSLDGILSKAQYHLKSGSSEQRTSCRATADQLCGEVERIQNLLGTKQSEADALAVL
KKAFQDQKEELLKSIEDIEERTDKERLKEPTRQALQQRLRVFNQLEDELNSHEHELCWLK
DKAKQIAQKDVAFAPEVDREINRLAVTWDDTKRLIHENQGQCCGLIDLMREYQNLKSAVS
KVLENASSVIVTRTTIKDQEDLKWAFSKHETAKNKMNYKQKDLDNFTSKGKHLLSELKKI
HSSDFSLVKTDMESTVDKWLDVAEKLEENMDRLRVSLSIWDDVLSSRDEIEGWSNNSVPQ
MAKNISNLDNRLRAEELLKEFESEVKNKALRLEELHSKVNDLKELTKNLETPPDLQFIEA
DLRQKLEHAKEITEVAKGTLKDFTAQSTQVEKFINDITTWLAKVEESLMNCAQTDTCEGL
KKVKDIQKELQSQQSNISSTQENLNSLCRKYHSAELENLGAMTGLIKKHEVAIEVLEKTQ
QDIRHSRNIHFFLSMQEFQEWFLGAKASAKESSDRTGDSKVLEAKLHDLQNLLDSVSDGQ
SKLDAVTQEGQTLYAHLSKQIVSSIQEQITKANEEFQAFLKQCLKDKQALQDCASELGSF
EDQHRKLNLWIHEMEERFNTENLGESKQHIPEMKNEVHKVEMFLGELLAARESLDKLSQR
GQLLSEEGHGAGQEGRLCSQLLTSHQNLLRMTKEKLRSCQVALQEHEALEEALQSMWSWV
KAIQDRLACAESTLGSKDTLEKRLSQIQDILLMKGEGEVKLNMAIGKGEQALRSSNKEGQ
RVIQTQLETLKEVWADIMSSSIHAQSTLESVISQWNDYLERKNQLEQWMESVDQKVEHPL
QPQPGLKEKFALLDRLQSILSEAEDHTRALHRLIAKSRELYEKTEDESFKDTAQEELKTQ
FNDIMTVAKEKMRKVEEIVKDHLMYLDAVHEFTDWLHSAKEELHRWSDMSGDSSATQKKL
SKIKELIDSREIGASRLSRVESLAPEVKQNTTASGCELMHTEMQALRADWKQWEDSVFQT
QSCLENLVSQMALSEQEFSGQAAQLEQALQEFSALLKTWAQQLTLLEGKNTDEEIVECWH
KGQEILDALQKAEPRTEDLKSQLNELCRFSRDLSTYSGKVSGLIKEYNCLCLQASKGCQN
KEQILQQRFRKAFRDFQQWLVNAKITTAKCFDIPQNISEVSTSLQKIQEFLSESENGQHK
LNVMLSKGELLSTLLTKEKAKGIQAKVSGAKEDWKNFHSNLHQKESALENLKIQMKDFEV
SAEPIQDWLSKTEKMVHESSNRLYDLPAKRREQQKLQSVLEEIHCYEPQLNRLKEKAQQL
WEGQAASKSFRHRVSQLSSQYLALSNLTKEKVSRLDRIVAEHNQFSLGIKELQDWMTDAI
HMLDSYCHPTSDKSVLDSRTLKLEALLSVKQEKEIQMKMIVTRGESVLQNTSPEGIPTIQ
QQLQSVKDMWASLLSAGIRCKSQLEGALSKWTSYQDDVRQFSSWMDSMEANLNESERQHA
ELRDKISMLGKAKLLNEEVLSYSSLLETIEVKGAGMTEHYVTQLELQDLQERYRAIQERA
KEAVTKSEKLVRLHQEYQRDLKAFEVWLGQEQEKLDQYSVLEGDAHTHETTLRDLQELQV
YCAEGQALLNSVLHTREDVIPSGIPQAEDRALESLRQDWQVYQHKLSETRTQFNNVVNKL
RLMEQKFQQVDEWLKTAEEKWHEEVTAYRDEVEEVGARAQEILDESHVNSRMGCQATQLT
SRYQALLLQVLEQIKFLEEEIQSLEESESSLSSYSDWYGSTHKNFKNVATKIDKVDTTMM
GKKLKTLEVLLKDMEKGHSLLKSAREKGERAVKYLEEGEADRLRKEIHDHVEQLKELTST
VRKEHMTLEKGLHLAKEFSDKCKALTQWIAEYQEILRVPEEPKMELYEKKAQLSKYKSLQ
QTVLSHEPSVKSVREKGEALLELVQDVTLKDKIDQLQSDYQDLCSIGKAMMEEIAGFEDR
LNNLQMKGDTLIGQCADHLQAKLKQNVHAHLQGTKDSYSAICSTAQRVYQSLEHELQKHV
SRQDTLQQCQAWLSTVQPDLEPSSQPPLSRAEAVKQVKHFRALQEQARTYLDLLCSMCDL
SNASVKTTAKDIQLTEQMIEQRLVQAQNLTQGWEEIKHLKAELWIYLQDADQQLQNMKRR
HSELELSIAQNMVSQVKDFVKKLQSKEASVNTIIEKVNKLTKKEESPEHKEINHLNDQWL
DLCHQSNNLCLQREEDLQRTRDYHDCMNVVEVFLEKFTTEWDNLARSDAESTAVHLEALK
KLALALQERKYAIEDLKDQKQKMIEHLNLDDKELVKEQTSHLEQRWFQLEDLIKRKIQVS
VTNLEELNVVQSRFQELMDWAEEQQPNIAEALKQSPPPDMAQNLLMDHLAICSELEAKQM
LLKSLIKDADRVMADLGLNERQVIQKALSDAQSHVNCLSDLVGQRRKYLNKALSEKSQFL
MAVFQATSQIQQHERKIMFREHICLLPDDVSKQVKTCKSAQASLKTYQNEVTGLWAQGRE
LMKGVTEQEKSEVLGKLQELQSVYDSVLQKCSHRLQELEKNLVSRKHFKEDFDKACHWLK
QADIVTFPEINLMNESTELHTQLAKYQHILEQSPEYENLLLMLQRTGQTILPSLNEVDHS
YLSEKLNTLPQQFNVIVALAKDKFYKVQEAILARKEYASLIELTTQSLSELEAQFSRMSK
VPTDLAVEEAVALQDGCRAILDEVVGLGEAVDELNQKKEGFRSTGQPWQPDKMLHLVTLY
HRLKRQTEQRVSLLEDTTSAYQEHEKMCQQLERQLKSVKEEQSKVNEETLPAEEKLKMYH
SLGGSLQDSAILLKRVTIHLEDLAPHLDPLAYEKARHQIQSWQEELKLLTSAIGETVTEC
ESRMVQSIDFQTEMSRSLDWLRRVKAELSGPVYLDLNLQDIQEEIRKIQIHQEEVQSSLR
IMNALSHKEKEKFTKAKELISADLEHSLAELSELDGDIQEALRTRQATLTEMFSQCQRYY
QVFQAANDWLEDAQEMLQLAGNGLDVESAEENLKNHMEFFSTEDQFHSNLEELRGLVATL
DPLIKPTGKEDLEQKMASLELRSQRMSQDSCAQVDLLQRCTAQWHDYQKAREEVIELMND
TEKKLSEFSLLKTSSSDEAEEKLSEHKVRVLFFFFLNPFSIIDSRWKCIAKILKRCSEQF
ASDKMWHLINRWTRLRAVAQDQEKILEDAVDEWTGFNNKVKKATEMIDQLQDKLPGSSAE
KASKAELLTLLEYHDTFVLELEQQQSALGMLRQQALSMLQDGATPTPGGEPPLMQEITAM
QDRCLNMQEKVKTNGKLVKQELKDREMVETQINSVKCWVQETKEYLGNPTIEIDAQLEEL
QILLTEATNHRQNIEKMAEEQKDKYLGLYTILPSELSLQLAEVALDLKIRDQIQDKIKEV
EQSKAMSQELSRQIQKIAKDLTTILTKLKAKTDNLVQAKTDQKVLGEELDGCNSKLMELD
AAVQKFSEQNGQLGKPLAKKIGKLTELHQQTIRQAENRLSKLNQAASHLEEYNEMLELIL
KWIEKAKVLAHGTIAWNSASQLREQYILHQTLLEESKEIHSDLEVMTEKLQYLTSVYCTE
KMSQQVAELGRETEELQQMIKIRLQNLQDAAKDMKKFEAELKKLQTALEQAQATLTSPEV
GRLSLKEQLSHRQHLLSEMESLKPKVQAVQLCQSALRIPEDVVASLPLCHAALRLQEEAS
RLQHTAIQQCNIMQAGAVVQYEQYEQEMKHLQQLIEGAHREIEDKPVATSNIQELQAQIS
RHEELAQKIKGYQEQIASLNSKCKMLTMKAKHATMLLTVTEVEGLAEGTEDLDGELLPAP
SAHPSVVMMTAGRCHTLLSPVTEESGEEGTNSEISSPPACRSPSPVANTDASVNQDIAYY
QALSAERLQTDAAKIHPSTSASQELYEPGLEPSATAKLGDLQRSWETLKNVISEKQRTLY
EALERQQKYQDSLQSISTKMEAIELKLSESPEPGRSPESQMAEHQVQIAMTSVSCLNKCT
LVTVWPVRHVFEIAINKSPNDELPLEILIVLLGCVLPVILMCSQGLEPLLYYKLNDQLEE
QRQEQALQRYRCEADELDSWLLSTKATLDTALGTPKEPMDMEAQLVDCQNMLVEIEQKVV
ALSELSVHNENLLLEGKAHTKDEAEQLAGKLRRLKGSLLELQRALHDKQLNMQGTAQEKE
ESDVDLTATQSPGVQEWLAQARTTWTHQRQSSLQQQKELEQELAEQKSLLRSVASRGEEI
LIQHSAAETSGDAGEKPDVLSQELGMEGEKSSAEDQMRMKWESLHQEFSTKQKLLQNVLE
QEQEQVLYSRPNRLLSGVPLYKGDVPIQDKSAVTSLLDGLNQAFEEVSSQSGGTKRQSIH
LEQKLYDGVSATSTWLDDVEERLFVATALLPEETETCLFNQEILAKDIKEMSEEMDKNKN
LFSQAFPENGDNRDVIEDTLGCLLGRLSLLDSVVNQRCHQMKERLQQILNFQNDLKVLFT
SLADNKYIILQKLANVFEQPVAEQIEAIQQAEDGLKELDAGIIELKRRGDKLQIEQPSMQ
ELSKLQDMYDELMMTIGSRRSGLNQNLTLKSQYERALQDLADLLETGQEKMAGDQKIIVS
SKEEIQQLLDKHKEYFQGLESHMILTETLFRKIISFAVQKETQFHTELMAQASAVLKRAH
KRGVELEYILETWSHLDEDQQELSRQLEVVENSIPSVGLVEENEDRLIDRITLYQHLKSS
LNEYQPKLYQVLDDGKRLLISISCSDLESQLNQLGERWLSNTNKVSKELHRLETILKHWT
RYQSESADLIHWLQSAKDRLEFWTQQSVTVPQELEMVRDHLNAFLEFSKEVDAKSSLKSS
VLSTGNQLLRLKKVDTATLRSELSHIDSQWTDLLTNIPAVQEKLHQLQMDKLPSRHAISE
VMSWISLMENVIQKDEDNIKNSIGYKAIHEYLQKYKGFKIDINCKQLTVDFVNQSVLQIS
SQDVESKRSDKTDFAEQLGAMNKSWQILQGLVTEKIQLLEGLLESWSEYENNVQCLKTWF
ETQEKRLKQQHRIGDQASVQNALKDCQDLEDLIKAKEKEVEKIEQNGLALIQNKKEDVSG
IVVGTLQGLGQTWASLDHMVGQLKILLKSVLDQWSNHKVAFDKINSYLMEARYSLSRFRL
LTGSLEAVQVQVDNLQNLQDDLEKQERSLQKFGSITNQLLKECHPPVTETLTNTLKEVNM
RWNNLLEEIAEQLHSSKALLQLWQRYKDYSKQCASSVQQQEDRTNELLKAATNKDIADDE
VATWIQDCNDLLKGLGTVKDSLFVLHELGEQLKQQVDASAASALQSDQLSLSQHLCALEQ
ALCKQQTSLQAGVLDYETFAKSLEALEAWIVEAEEILQGQDPSHSSDLSTIQERMEELKG
QMLKFSSMAPDLDRLNELGYRLPLNDKEIKRMQNLNRHWSLISSQTTERFSKLQSFLLQH
QTFLEKCETWMEFLVQTEQKLAVEISGNYQHLLEQQRAHELFQAEMFSRQQILHSIIIDG
QRLLEQGQVDDRDEFNLKLTLLSNQWQGVIRRAQQRRGIIDSQIRQWQRYREMAEKLRKW
LVEVSYLPMSGLGSVPIPLQQARTLFDEVQFKEKVFLRQQGSYILTVEAGKQLLLSADSG
AEAALQAELTEIQEKWKSASVRLEEQKKKLAFLLKDWEKCEKGIADSLEKLRTFKKKLSQ
CLPDHHEELHAEQMRCKELENAVGSWTDDLTQLTLLKDTLSAYISADDISILNERIELLQ
RQWEELCHQLSLRRQQIGERLNEWAVFSEKNKELCEWLTQMESKVSQNGDILIEEMIEKL
KKDYQEEIAVAQENKIQLQQMGERLAKASHESKASEIEYKLGKVNDRWQHLLDLIAARVK
KLKETLVAVQQLDKNMSSLRTWLAHIESELAKPIVYDSCNSEEIQRKLNEQQELQRDIEK
HSTGVASVLNLCEVLLHDCDACATDAECDSIQQATRNLDRRWRNICAMSMERRLKIEETW
RLWQKFLDDYSRFEDWLKTSERTAAFPSSSGVIYTVAKEELKKFEAFQRQVHECLTQLEL
INKQYRRLARENRTDSACSLKQMVHEGNQRWDNLQKRVTSILRRLKHFIGQREEFETARD
SILVWLTEMDLQLTNIEHFSECDVQAKIKQLKAFQQEISLNHNKIEQIIAQGEQLIEKSE
PLDAAIIEEELDELRRYCQEVFGRVERYHKKLIRLPLPDDEHDLSDRELELEDSAALSDL
HWHDRSADSLLSPQPSSNPSLSLAQPLRSERSGRDTPASVDSIPLEWDHDYDLSRDLESA
VSRALPSEDEESQDDKDFYLRGAVGLSDVMIPESPEAYVKLTENAIKNTSGDHSALESQI
RQLGKALDDSRFQIQQTENIIRSKTPTGPELDTSYKGYMKLLGECSGSIDSVKRLEHKLK
EEEESLPGFVNLHSTETQTAGVIDRWELLQAQALSKELRMKQNLQKWQQFNSDLNSIWAW
LGDTEEELEQLQRLELSTDIQTIELQIKKLKELQKAVDHRKAIILSINLCSPEFTQADSK
ESRDLQDRLSQMNGRWDRVCSLLEEWRGLLQDALMQCQGFHEMSHGLLLMLENIDRRKNE
IVPIDSNLDAEILQDHHKQLMQIKHELLESQLRVASLQDMSCQLLVNAEGTDCLEAKEKV
HVIGNRLKLLLKEVSRHIKELEKLLDVSSSQQDLSSWSSADELDTSGSVSPTSGRSTPNR
QKTPRGKCSLSQPGPSVSSPHSRSTKGGSDSSLSEPGPDRSSRAFLFRVLRAALPLQLLL
LLLIGLACLVPMSEEDYSCALSNNFARSFHPMLRYTNGPPPL
Download sequence
Identical sequences ENSMMUP00000025067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]