SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025157 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025157
Domain Number 1 Region: 544-721
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.57e-41
Family SPRY domain 0.00034
Further Details:      
 
Domain Number 2 Region: 349-541
Classification Level Classification E-value
Superfamily Fibronectin type III 1.34e-25
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 3 Region: 151-201
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000755
Family B-box zinc-binding domain 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000025157
Domain Number - Region: 183-277
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0641
Family Apolipoprotein A-I 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025157   Gene: ENSMMUG00000019138   Transcript: ENSMMUT00000026888
Sequence length 727
Comment pep:known_by_projection chromosome:MMUL_1:7:63726309:63783110:1 gene:ENSMMUG00000019138 transcript:ENSMMUT00000026888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLHDSEDRLQLFPEENTRMRKEVVQAEMANESRGAGDGKAQRDLQEEVDELVHLYGLED
DHELRDEFVDENMPRTGVSEYPPYVMKRRDPAREQRDWRPSGETVEAEDLGFGGWGSAGQ
CQDLREAYRYTHGRASEEYECYVIPEEEDEEEAADVFCVTCKTPIRAFQKVFDEHKEHEV
IPLNEALESAKDEIHKNMYKLEKQIIQMENFANHLEEVFITVEENFGKQEQNFESHYNEI
LETLAQKYEEKIQALGEKKKEKLEALYGQLVSCGENLDTCKELMETIEEMCHEEKVDFIK
DAVAMADRLGKFLKAKTDVEISAQPEFEDQTLDFSDVEQLMGSINTIPAPSAPVINPQAP
NSATGSSVRVCWSLYSDDTVESYQLSYRPVQDSSPGKDQAEFTVTVKETYCSVTNLVPNT
QYEFWVTAHNRAGPSPSSEHAVYMTAPSPPIIKTKEIRSCEEAVLICWESGNLNPVDSYT
VELTQAESPEASGVTESVVGIPTCESLVQLQPGRSYIICVRALNMGGPSVRSEPATVHTI
GSYFRLNKDTCHPWLIISEDGLTVVRSERRIPARELSSSDSRFTRCVAVMGNLIPVRGHH
YWEVEVDEHLDYTVGVAFEDVTKQEDLGANCLSWCMRHTFASSRHRYEFLHNRTTPDIRI
TVPPKKIGILLDYENSKLSFFNVDLSQHLYTFSCQLHEFVHPCFSLETPGCLKVHNGISM
PKHVTFY
Download sequence
Identical sequences ENSMMUP00000025157 XP_001082154.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]