SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025171 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025171
Domain Number 1 Region: 152-296,335-350,431-473
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.76e-53
Family Hemopexin-like domain 0.00059
Further Details:      
 
Domain Number 2 Region: 21-67
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000000196
Family Somatomedin B domain 0.0000505
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025171   Gene: ENSMMUG00000019148   Transcript: ENSMMUT00000026903
Sequence length 479
Comment pep:known_by_projection chromosome:MMUL_1:16:23549616:23552652:-1 gene:ENSMMUG00000019148 transcript:ENSMMUT00000026903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPLRPLLMLALLAWVAVADQESCKGRCTEGFNADKKCQCDELCSYYQSCCTDYTAECKP
QVTRGDVFTMPEDEYVTYDYGEEKNNATIHEQPEGSSPSPDLQAQPEGTPEQATVLNPEE
ESPAPEVGISKPEGTDSRPETLRPGTPELPAEEELCSGKPFDAFTDLKNGSLFAFRGQYC
YELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYP
RNISDGFDGMPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSRSA
VFEHFAVMQRDSWEDIFELLFWGRTSAGMRQPQLISRDWHGVPGQVDAAMAGRIYVSGMA
PHPSLAKKQKFRRRNRKGYRSDRGHSRGRNQNSRRPSRPTWRLSLFSSEESNLGANNYDD
YRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDAVDPPYPRSIAQYWLGCPAPGHL
Download sequence
Identical sequences XP_001106884.1.72884 ENSMMUP00000025171 9544.ENSMMUP00000025171 ENSMMUP00000025171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]