SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025179 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025179
Domain Number 1 Region: 226-539
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 7.12e-69
Family N-type ATP pyrophosphatases 0.000000737
Further Details:      
 
Domain Number 2 Region: 1-191
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 5.4e-43
Family Class II glutamine amidotransferases 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025179   Gene: ENSMMUG00000019157   Transcript: ENSMMUT00000026912
Sequence length 561
Comment pep:known_by_projection chromosome:MMUL_1:3:119411249:119430985:1 gene:ENSMMUG00000019157 transcript:ENSMMUT00000026912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQ
PIRVKNYPYLWLCYNGEIYNYKKMQRHFEFEYQTNVDGEIILHLYDKGGIEQTICMLDGV
FAFVLLDTANKKVFLGRDTYGVRPLFKAITEDGFLAVCSEAKGLVTLKHSTTPFLKVEPF
LPGHYEVLDLKPNGKVASVEMVKYHHCRDEPLHALYDNVDKLFPGFEIETVKNNLRILFN
NAVKKRLMTDRRIGCLLSGGLDSSLVAATLLKQLKEAQVQYPLQTFAIGMEDSPDLLAAR
KVANHIGSEHYEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDNVV
IFSGEGSDELTQGYIYFHKAPSPEEAEEESERLLRELYLFDVLRADRTTAAHGLELRVPF
LDHRFSSYYLSLPPEMRTPKNGIEKHLLRETFEESNLIPKEILWRPKEAFSDGITSVKNS
WFKILQEYVEHQVDDAMMANAAQKFPFNTPKTKEGYYYRQIFERHYPGRADWLSHYWMPK
WINATDPSARTLTHYKSAAKA
Download sequence
Identical sequences F6SSI3
XP_001089182.1.72884 XP_001089407.1.72884 XP_014989793.1.72884 XP_014989794.1.72884 XP_014989796.1.72884 ENSMMUP00000025179 ENSMMUP00000025179 9544.ENSMMUP00000025179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]