SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025315 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025315
Domain Number 1 Region: 38-326,511-574
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.67e-89
Family FAD-linked reductases, N-terminal domain 0.00019
Further Details:      
 
Domain Number 2 Region: 333-515
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.55e-55
Family GMC oxidoreductases 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025315   Gene: ENSMMUG00000019266   Transcript: ENSMMUT00000027059
Sequence length 594
Comment pep:known chromosome:MMUL_1:2:82500029:82523923:1 gene:ENSMMUG00000019266 transcript:ENSMMUT00000027059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWCLLRGLGRPGALARGALGQQQPLGARALARAGSESRDEYSYVVVGAGSAGCVLAGRLT
EDPAERVLLLEAGPKDVRAGSKRLLWRIHMPAALVANLCDNRYNWCYHTEAQQGLDGRVL
YWPRGRVWGGSSSLNAMVYVRGHAEDYERWQRQGAGGWDYAHCLPYFRKAQGHELGASRY
RGADGPLRVSRGKTNHPLHCAFLEAAQQAGYPLTEDMNGFQQEGFGWMDMTIHEGKRWSA
ACAYLHPALSRTNLKAEAQTLVSRVLFEGTRAVGVEYVKNGQSHRAYASKEVILSGGAIN
SPQLLMLSGIGNADDLKKLGIPVVCHLPGVGQNLQDHLEIYIQQACTHPITLHSAQKPLQ
KVCIGLEWLWKFTGKGATAHLETGGFIRSQPGVPHPDIQFHFLPSQVIDHGRVPTQQEAY
QVHVGPVRGTSVGWLKLRSANPQDHPVIQPNYLSTETDIEDFRLCVKLTREIFAQEALAP
FRGKELQPGSHVQSDKEIDAFVRAKADSAYHPSCTCKMGQPSDPTAVVDPQTRVLGVENL
RVVDASIMPSVVSGNLNAPTIMIAEKAADIIKGRPVLWDKDVPVYKPRTLATQR
Download sequence
Identical sequences F6SIV5
ENSMMUP00000025315 9544.ENSMMUP00000025315 ENSMMUP00000025315 NP_001244738.1.72884 XP_014986022.1.72884 XP_014986023.1.72884 XP_014986024.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]