SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025375 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025375
Domain Number 1 Region: 53-82
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000205
Family LIM domain 0.01
Further Details:      
 
Domain Number 2 Region: 8-38
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000263
Family LIM domain 0.0091
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000025375
Domain Number - Region: 83-113
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00326
Family LIM domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025375   Gene: ENSMMUG00000019317   Transcript: ENSMMUT00000027126
Sequence length 124
Comment pep:known chromosome:MMUL_1:11:16961786:17014393:-1 gene:ENSMMUG00000019317 transcript:ENSMMUT00000027126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSVQPDTKPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCWERLFGVTGNCAACS
KLIPAFEMVMRAKDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKEGYA
PQVR
Download sequence
Identical sequences ENSMMUP00000025375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]