SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025453 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025453
Domain Number 1 Region: 27-67
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000000327
Family Somatomedin B domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025453   Gene: ENSMMUG00000019373   Transcript: ENSMMUT00000027209
Sequence length 275
Comment pep:known chromosome:MMUL_1:1:184420539:184430271:-1 gene:ENSMMUG00000019373 transcript:ENSMMUT00000027209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWKTLPIYLLLLLSVFVIQQVSSQELSCKGRCFESFERGRECDCDAQCKKYDKCCPDYE
SFCAEVHNPTSPPSAKKAPPPSGASQTIKSTTKRSPKPPNKKKTKKVVESEEITEEHSVS
ENQESSSSSSSSSSSSTIRKIKSSKNSAANRELQKKLKGKDNKKNRTKKKPTPKPPVVDE
AGSGLDNGDFKVTTTPATSTTQHNKVTTSPKITTAKPKNPRPSLPPNSDTSKQTSLTTNK
ETTVETKEPTTTNKQTSHDGKETTSAKETQSVEKT
Download sequence
Identical sequences ENSMMUP00000025453 9544.ENSMMUP00000025453 ENSMMUP00000025453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]